(data stored in ACNUC7421 zone)

EMBL: CP001389.FABG2

CP001389.FABG2       Location/Qualifiers
FT   CDS_pept        complement(696355..697146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG2"
FT                   /locus_tag="NGR_c06410"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="3-ketoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24434"
FT                   /db_xref="GOA:C3MI86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI86"
FT                   /protein_id="ACP24434.1"
FT                   /translation="MRLNGKTAIVTGAARGIGRAIAVAFAREGAQVVVCDRDEEAAKLT
FT                   AEEIGSAALAVRADISVDEDVSGLVDQALARFGKIDILVNNAGIGATTLFLESSREEFE
FT                   RVVRINLTGTFLVSQAVARTMAEHKSGSIVNIASLSGQKGGVGRSAYGASKAGVELLNK
FT                   VMAVELADHGINVNAIAPGPILTEVSRTMHTIETREAYHRLVPQRRYGEPEEIADAAVF
FT                   LASEEARYITGHTLNVDGGFLAAGLLFPFDPKTSKKLGDER"
     atgcgtttga acgggaaaac agccattgta acgggcgccg cccgtggcat cggcagagcc        60
     atcgccgttg cttttgcccg cgaaggggct caagtcgtgg tctgcgaccg cgacgaagaa       120
     gcggccaagc tcactgcgga ggaaatcggt tccgcggcgc tggccgtccg tgcggacatc       180
     tccgtcgatg aagacgtgag cggtctggtc gatcaagcgc tcgcgcgctt cggcaagatc       240
     gacatcttgg tgaataatgc tggaattggc gcgacaaccc tgtttttgga aagttcgagg       300
     gaagagtttg agcgggtcgt tcgcatcaat ctcacgggca cgttcttggt gtcccaggcg       360
     gtcgcgcgga ctatggctga acacaagagc ggttcgatcg tgaatatcgc ttcgctgtct       420
     ggacaaaagg gtggcgtcgg tcggtccgct tacggcgcgt caaaggccgg cgttgagctg       480
     ctcaacaagg tcatggccgt tgaactggcc gaccacggca tcaatgtgaa cgcaatcgct       540
     cccggaccga ttctgacgga agtttcgcgt actatgcaca ccatcgagac cagggaagcc       600
     taccaccgtc tggttccaca gcgtcgctat ggcgagccgg aggagattgc cgatgccgct       660
     gtatttctcg ctagcgagga agcgcgctac atcacgggcc atactttgaa tgtcgatggc       720
     ggcttcctgg ccgcaggact gttgttcccg tttgatccca agacatccaa aaagctcggc       780
     gacgaaaggt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page