(data stored in ACNUC7421 zone)

EMBL: CP001389.FABI3

CP001389.FABI3       Location/Qualifiers
FT   CDS_pept        574113..574931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI3"
FT                   /locus_tag="NGR_c05170"
FT                   /product="NADH-enoyl acyl carrier protein reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24313"
FT                   /db_xref="GOA:C3MHI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI5"
FT                   /protein_id="ACP24313.1"
FT                   /translation="MAQASGLMNGKRGVIMGVANNRSIAWGIAKALAEAGADIALTWQG
FT                   DALKKRVEPLAQELGAFMAGHCDVTDLATIDGVFSALEEKWGKIDFVVHAIAFSDKDEL
FT                   TGRYLDTSRDNFTRTMDISVYSFTAVAARAERIMNDGGSMLTLTYYGAEKVMPHYNVMG
FT                   VAKAALEASVRYLAVDLGNRGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLKRT
FT                   VSIEEVGNSALYLLSNLSTGVTGEVHHVDSGYHTVGMKAVDAPDISVLKD"
     atggctcagg catcgggtct gatgaatggc aagcgcggcg tcatcatggg cgtcgcaaac        60
     aatcgctcga ttgcgtgggg catcgccaag gctttggctg aagcgggcgc cgacattgcg       120
     ctgacatggc agggcgatgc gctgaagaag cgcgtcgagc cgctggcgca ggaactcggc       180
     gccttcatgg ccggacattg cgatgtgacc gaccttgcta cgatcgacgg cgttttctcg       240
     gcgcttgagg aaaaatgggg caagatcgat ttcgtagtgc acgcgatcgc cttctccgac       300
     aaggacgaac tgacgggccg ctacctcgat acgagccgcg acaacttcac ccgcacgatg       360
     gatatttccg tctactcctt cacggccgtt gcagcgcgtg ccgagcgcat catgaatgac       420
     ggcggctcga tgctgacgct cacctattac ggcgccgaaa aggtaatgcc gcactacaac       480
     gtcatgggtg tcgccaaggc agcgctcgaa gcaagcgtgc gttatctcgc cgtcgatctc       540
     ggcaaccgcg gcatccgcgt caatgcgatc tcggccggcc cgatcaagac gcttgccgcc       600
     tccggcatcg gtgatttccg ctatatcctc aagtggaacg agtacaatgc gccgctgaag       660
     cgcaccgttt cgatcgagga ggtcggcaat tcggcgctct atctcctgtc caacctgtcc       720
     accggggtga ccggcgaggt gcaccacgtc gattccggtt atcatacggt cggcatgaaa       780
     gcggtcgacg ccccggacat ttccgtcctg aaggattga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page