(data stored in ACNUC7421 zone)

EMBL: CP001389.FLAF

CP001389.FLAF        Location/Qualifiers
FT   CDS_pept        336886..337233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="NGR_c02970"
FT                   /product="predicted flagellar protein FlaF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24095"
FT                   /db_xref="GOA:C3MG44"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG44"
FT                   /protein_id="ACP24095.1"
FT                   /translation="MYQFAYAEIMEEGVAVSKDREWQVLNRSIALLEAAKQQKGYSREA
FT                   IEAIYYTRRVWIRFIEDLRAPDNQLNDELRANLISIGIWILNETEKIRKRDSSNFQGII
FT                   DITTIIRDGLK"
     atgtatcagt ttgcatacgc cgagatcatg gaggaaggcg tagccgtttc caaggatcgc        60
     gagtggcagg tcctcaatcg ctcgatcgcg ctcctggaag cagccaaaca gcagaaggga       120
     tactcaagag aagcgatcga ggcgatctac tacacccgac gagtctggat acgcttcatc       180
     gaggatctgc gcgccccgga taaccagctc aatgacgaat tgcgtgccaa cctgatctcg       240
     atcgggatct ggatactgaa cgagacggag aagatccgca aacgcgactc ctccaacttc       300
     cagggcataa ttgacattac caccatcatc agggatggac tgaaatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page