(data stored in ACNUC7421 zone)

EMBL: CP001389.FLBT

CP001389.FLBT        Location/Qualifiers
FT   CDS_pept        337230..337679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="NGR_c02980"
FT                   /product="predicted flagellum biosynthesis repressor
FT                   protein FlbT"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24096"
FT                   /db_xref="GOA:C3MG45"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG45"
FT                   /protein_id="ACP24096.1"
FT                   /translation="MKSTLRISLKSGERIFVNGAVLRVDRKVAVEFLNDVTFLLENHVL
FT                   QPEDATTPLRQLYFIAQMILINPEGAEQSTAMFRKSIVMLLACFKNEEVLAELKRIDGL
FT                   VTQGRAFEALKAIRGLYPIEERILNNQEITPATIDQIRKEIAPWR"
     atgaagagca cactgcgtat ctcgctgaaa tcgggcgaac ggatctttgt aaacggcgcg        60
     gtgcttcgcg ttgatcgcaa ggttgccgtc gaattcctca acgacgtaac cttccttctg       120
     gaaaaccatg tcctgcagcc ggaagatgcc acgacaccgc tgcggcagct ctatttcatc       180
     gcccagatga tcctgatcaa tccggaaggc gccgagcaat cgaccgccat gttccgcaag       240
     tcgatcgtca tgctgctcgc ctgcttcaag aacgaggaag tgctggccga actgaagcgc       300
     atcgacggcc tggtcaccca gggccgcgcc ttcgaagcgt tgaaggcgat ccgtggcctg       360
     taccccatcg aagagcgcat cctgaacaat caggaaatca ccccggccac catcgaccag       420
     attcgcaagg agatcgcgcc atggcggtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page