(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGB

CP001389.FLGB        Location/Qualifiers
FT   CDS_pept        315625..316005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="NGR_c02740"
FT                   /product="putative flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24072"
FT                   /db_xref="GOA:C3MG21"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG21"
FT                   /protein_id="ACP24072.1"
FT                   /translation="MDPIQLFELASRQAQWLTVRQNVVAGNIANANTPHYRAKDVQPFE
FT                   SVLQNTGVQMAATHRAHFTESPDAAQVTDVGMIDDVAVQQSGNTVALEQEMMKTGEIKR
FT                   DYELNSGLVKSFHRMMLMTVRK"
     atggatccga ttcagctttt cgaactcgcg tcgcgccagg cccagtggct gacggtccgc        60
     cagaatgtcg tggccggcaa catcgccaat gccaacacgc cgcattacag ggccaaggac       120
     gtccagccct tcgaaagcgt actccagaac accggcgtcc agatggccgc gacgcatcgt       180
     gcccatttca ccgagagccc ggatgccgcg caggtgaccg acgtcggcat gatcgacgac       240
     gtggcggtcc agcagtccgg caacaccgtc gcgctcgagc aggaaatgat gaagacgggc       300
     gagatcaagc gcgactacga actcaattcc ggactggtga aatcctttca ccggatgatg       360
     ctcatgacgg tacggaaata a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page