(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGC

CP001389.FLGC        Location/Qualifiers
FT   CDS_pept        316011..316430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="NGR_c02750"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24073"
FT                   /db_xref="GOA:C3MG22"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG22"
FT                   /protein_id="ACP24073.1"
FT                   /translation="MDPLTSALKVSASGLQAESTRLRIVSENIANARSTGDVPGADPYR
FT                   RKTISFAAEVDRASGASLVEVQRLGTDDSDFSIEFDPGNPAADEKGMVKMPNVNVLIEM
FT                   ADMREANRAYEANLQTVKQSRDLISQTIDLLRASQ"
     atggatcctt tgacctcggc actcaaggtt tcggcttcgg gcctgcaggc ggagtcgacg        60
     cgcctgcgca tcgtttccga aaacatcgcc aatgcccgct ccaccggcga cgtgcccggc       120
     gccgacccct atcgccgcaa gacgatttcc ttcgccgcgg aagtcgaccg ggcgagcggc       180
     gcatcgctcg tcgaggtcca gcgcctcggc accgacgatt cggatttcag catcgagttc       240
     gatcccggca atccggccgc cgatgagaag ggcatggtga agatgccgaa tgtcaacgtc       300
     ctgatcgaga tggccgacat gcgcgaagcc aaccgcgcct acgaggccaa cctgcagacc       360
     gtcaagcagt ctcgcgatct catctcccag acaatcgacc tgttgagggc ctcgcaataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page