(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGD

CP001389.FLGD        Location/Qualifiers
FT   CDS_pept        337670..338116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="NGR_c02990"
FT                   /product="predicted flagellar hook capping protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24097"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG46"
FT                   /protein_id="ACP24097.1"
FT                   /translation="MAVSGVSSSASASTTSTTSTTSTSSTDAADATLNYQSFLKLLIAQ
FT                   MQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLESLLASESLTQASTYIGKTITSSD
FT                   GKTSGVVAEVEVTSDGVTAITTDGKEIAIETGISVSTTSSDSET"
     atggcggtaa gcggtgtgtc gtcgagcgca tcagcgagca cgacatcgac gacgagcacg        60
     acatcgacga gcagtacgga cgcggctgac gcgaccctga actatcagag cttcctgaag       120
     ctgctcatcg cgcagatgca aaatcaggat ccgaccgatc cgatggatgc gacggagcag       180
     atttcgcagc ttgcgacctt ctcgcaggtc gaacaatcga tcaagacgaa cagcaatctg       240
     gaaagcttgc tggcgagcga aagcctgacc caggcatcga cctatatcgg caagacgatc       300
     acgagcagcg acggcaagac gagcggtgtc gttgccgagg tcgaggtcac gtcggatggc       360
     gtgacggcga tcacgaccga cggcaaggag atcgccatcg agaccgggat aagcgtgtcg       420
     acgacctcgt ccgattcgga aacgtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page