(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGF

CP001389.FLGF        Location/Qualifiers
FT   CDS_pept        312598..313323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="NGR_c02710"
FT                   /product="Flagellar basal-body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24069"
FT                   /db_xref="GOA:C3MG18"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG18"
FT                   /protein_id="ACP24069.1"
FT                   /translation="MQTGLYVALSSQMALEKRLNTLADNIANANTVGFRSTEVKFDQVL
FT                   GDTKPSKVSYVSEGEEYLNTGNGALARTGSALDFAIKGNAWFNIDTPGGPALTRDGRFT
FT                   LTETGELVTLKGYPVLDAGGAPIQLNGGAGEITVGADGAIHQNGVQVALLGLYEADFSS
FT                   GFVRYDNSAVMPAAQPEPVVDRFDVGVMQGFLEESNVNAVQEMTQLIMVTRAFDNVTAL
FT                   MRDSEGSLEEAIKTLGGER"
     gtgcagaccg ggctctatgt ggcgctttca tcacagatgg cgcttgagaa gcgcttgaac        60
     acgcttgccg acaacatcgc gaacgccaat acggtcggct tccgctccac ggaagtgaaa       120
     ttcgaccagg ttctcggcga tacgaagccg tccaaggtct cttacgtatc cgaaggcgag       180
     gaatacttaa acaccggcaa cggcgccttg gcgcggaccg gttctgcgct cgacttcgcc       240
     atcaagggga acgcctggtt caacatcgac acgcccggcg ggccggcgct gacccgtgac       300
     ggccgtttca ccctgacgga gaccggcgag ctggtgaccc tcaagggata tccggtgctg       360
     gacgccggcg gtgcaccgat tcagctgaac ggcggtgccg gcgagatcac cgtcggcgcc       420
     gacggagcca tccaccagaa cggcgtccag gtcgccctgc tcggcctcta cgaggcggat       480
     ttctccagcg gcttcgtgcg ctatgacaac agtgccgtca tgccggccgc tcaaccggag       540
     cccgtcgtcg accgcttcga cgtcggcgtg atgcagggct tcctcgaaga gtcgaacgtc       600
     aatgccgtcc aggaaatgac ccagctcatc atggtgacgc gcgcctttga caacgtcacg       660
     gctttgatgc gcgacagcga aggatcgctt gaagaggcga tcaagacgct cggcggcgag       720
     cgctag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page