(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGG

CP001389.FLGG        Location/Qualifiers
FT   CDS_pept        316777..317565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="NGR_c02770"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24075"
FT                   /db_xref="GOA:C3MG24"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG24"
FT                   /protein_id="ACP24075.1"
FT                   /translation="MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLY
FT                   QTERAQGVPNRSNQAIVPEGAIVGLGVQTAAVRNLHVQGSLVNTSNDLDLALVGRGWFQ
FT                   VETPNGETVYTRSGAFNTNATGQLVTIDGYTVVPGITVPQDATEITVSASGQVLVRIGD
FT                   ATETQEIGQLTIANFVNEAGLEPQGENLFKQTAASGEPIVGTPADPGFAQIKQGYLESS
FT                   NVDPVKEITDLISAQRAYEMNSKVIQAADEMAATVSKNLR"
     atgaaggccc tttccatcgc cgccacgggc atgaacgccc agcagctgaa cctcgaagtc        60
     atcgccaaca acatcgccaa catcaacacg accggctaca agcgggcgcg cgcggaattt       120
     tcggatctgc tctaccagac ggagcgcgcc cagggcgtgc cgaaccgctc caaccaggcg       180
     atcgtgccgg aaggggcgat cgtcggtctc ggtgtccaga cggccgccgt ccgcaacctc       240
     cacgtccagg gcagcctcgt caacaccagc aacgatctcg accttgcgct tgtcggccgc       300
     ggctggttcc aggtcgaaac gcccaacggc gaaacggtct atacccgctc gggcgccttc       360
     aacaccaacg ccaccggcca actcgtcacc atcgacggct acacggtcgt tcccggcatc       420
     accgtgccgc aggacgcgac cgagatcacc gtctcggctt ccggccaagt cctggtgcgg       480
     atcggcgacg cgacggaaac ccaggaaatc ggtcagttga cgatcgccaa tttcgtcaac       540
     gaggccgggt tggagccgca gggcgaaaac ctcttcaagc agacagccgc atccggcgaa       600
     ccgatcgtcg gcacgccggc cgatcccggc ttcgcgcaga tcaagcaggg ctatctggaa       660
     tcctccaacg tcgatccggt caaggaaatc accgacctga tctcggccca gcgcgcctac       720
     gaaatgaact ccaaggtcat ccaggccgcg gacgagatgg ccgccacggt gagcaagaac       780
     ctcaggtaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page