(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGH

CP001389.FLGH        Location/Qualifiers
FT   CDS_pept        319738..320448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="NGR_c02810"
FT                   /product="flagellar L-ring protein precursor (basal body
FT                   L-ring protein) FlgH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24079"
FT                   /db_xref="GOA:C3MG28"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG28"
FT                   /protein_id="ACP24079.1"
FT                   /translation="MRMQLTAVLAASLLAGCQNQAFREIGQAPSMSPIGSGLQYTQAPQ
FT                   LAAYPKQPHQMTAGYSLWNDQQAALFKDARAINVGDILTVDIQIDDKASFNNETDRSRT
FT                   NSSGFNLGASGESQTSDFEWSGNLKYGSNIKTEGDGKTERSEKLRLLVAAVVTGVLENG
FT                   NLLISGSQEVRVNHELRILNVAGIVRPRDVDADNIISYDRIAEARISYGGRGRLMEVQQ
FT                   PPWGQQVVDLVSPI"
     atgagaatgc aacttacggc cgttctggcc gcgagccttc ttgcgggatg ccagaaccag        60
     gccttcaggg agatcggcca ggcgccgtcg atgagcccga tcggcagcgg cctgcaatat       120
     acgcaggcgc cgcaattggc ggcgtatccg aagcagccgc atcagatgac cgccggatac       180
     tcgctgtgga acgaccagca ggccgccctc ttcaaggacg cgcgcgcgat caatgtcggc       240
     gatatcctga ccgtcgatat ccagatcgac gacaaggcgt cgttcaacaa cgaaacggac       300
     cgcagccgca ccaattccag cggcttcaac ctcggcgcca gcggtgaatc gcagaccagc       360
     gacttcgaat ggtccggcaa tctcaaatac gggtcgaaca tcaagaccga aggcgacggt       420
     aagaccgagc gctccgagaa gctccggctg ctcgtcgccg ccgttgtcac cggtgtcctg       480
     gagaacggca atctgctgat cagcggctcg caggaagtgc gcgtcaacca cgaactgcgc       540
     atcctcaatg tcgccggcat cgtccggccg cgggatgtcg acgccgacaa tatcatttcc       600
     tacgaccgca ttgccgaggc gcgtatctcc tacggtggcc gcggccggct gatggaagtg       660
     cagcagccgc catggggcca gcaggtcgtc gatctcgtct caccgatttg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page