(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGK

CP001389.FLGK        Location/Qualifiers
FT   CDS_pept        334363..335793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="NGR_c02950"
FT                   /product="predicted flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24093"
FT                   /db_xref="GOA:C3MG42"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG42"
FT                   /protein_id="ACP24093.1"
FT                   /translation="MSLSSAIAIAQSAFSTTASQTATVSKNVANASNADYSRRMAMLGT
FT                   TADGAQIVSIYRAQNEALLKQNLTSISQSSAQSSLLSGLELLKSALGGNDYETAPSTYL
FT                   SAFRDSLQTFASTPGNSTIAATVVADASDLANSISKTATAVQDLRLDTDKQIAEEVDNL
FT                   NALLASFETANNAVKQATATGADATAALDERDKLLKQLSELVGISTVTRADNDTVIYTS
FT                   DGTVLFETQARQVTFTATSAFDASTTGNAIFIDGVSLSAGAGADTTAEGKLASLLQLRD
FT                   DIAPTFQSQLDEMARGLVSLFQEDGAPGLFTWEDGTLPADGTVEPGIAATLSVNAAAQT
FT                   NPFLLRDGGFNGLVSNPGGATDPNSGYTDLLDGFITAMDGDMDFDAAAGLDSTSSIMEF
FT                   AASSIGWFEQIRSAASTADDNKTALLARTEEALGNVTGVSIDEELSLLLDLEQSYKASA
FT                   KLISTVDAMMASLLEAVR"
     atgtcgttgt cctcggcaat cgcgattgcg caatcagcat tcagcaccac cgcctcgcaa        60
     acggccacgg tgtcgaagaa cgtcgccaat gcgagcaacg cagactactc gcgccgcatg       120
     gccatgctgg gaacgacggc cgatggcgcc cagatcgttt ccatttaccg ggcccagaac       180
     gaggctctgc tcaagcagaa cctgacaagc atctcgcaat cctcggcaca gagcagcctg       240
     ctttcggggc tcgagctgtt gaagtcggcg cttggcggca acgactacga gacggcgccg       300
     tcgacctatc tctccgcatt ccgcgacagc ctgcagacct tcgcctcgac ccccggcaat       360
     tcgacgatcg ccgcgaccgt cgtcgccgat gcgtcggatc ttgccaactc gatcagcaag       420
     acggcgaccg ccgtccagga cctgcgtctc gataccgaca agcagattgc cgaagaggtc       480
     gacaacctga acgcactctt ggcgagcttc gaaacggcga acaatgccgt caagcaggcg       540
     acggcgacgg gcgccgacgc cacggccgca ctcgacgagc gcgacaagct gttgaagcag       600
     ctctcggagc tcgtcggcat ctccactgtc accagggcgg acaacgatac cgttatatac       660
     acctcggacg gcaccgtgct cttcgagacc caggcccggc aggtgacgtt cacggccacc       720
     tcggcctttg acgcgtcgac gaccggcaac gccatcttca tcgatggcgt gtcgctttcg       780
     gccggcgccg gcgcggacac caccgccgag ggaaagcttg cgagccttct ccagcttcgc       840
     gacgacatcg ctccgacgtt ccagtcgcaa ctcgatgaga tggcccgcgg actggtcagc       900
     cttttccagg aggacggcgc ccccggcctc ttcacctggg aggacggaac gcttccggcg       960
     gacggcacgg tcgagcccgg catcgcggcg acgctgagcg tcaacgccgc cgcccaaacc      1020
     aatcccttcc tgctgcgcga cggcggattc aacggccttg tctccaatcc gggcggcgcc      1080
     acggatccga attccggcta caccgatctc ctcgacggct tcatcaccgc catggacggc      1140
     gacatggatt tcgacgcggc ggccggactg gacagcacca gttcgatcat ggagttcgcc      1200
     gcctcgtcga tcggctggtt cgaacagatc cgcagcgccg cctcgacggc cgacgacaac      1260
     aagacggctc tgttggcgcg gaccgaggag gctctgggca acgtgaccgg ggtcagcatc      1320
     gatgaagagc tgtcgctgct gctcgacctc gagcagtctt acaaggcatc tgccaagttg      1380
     atcagtaccg tggacgccat gatggcgtct cttctggaag ccgtgaggta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page