(data stored in ACNUC7421 zone)

EMBL: CP001389.FLHB

CP001389.FLHB        Location/Qualifiers
FT   CDS_pept        complement(306825..307907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="NGR_c02650"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24063"
FT                   /db_xref="GOA:C3MG12"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG12"
FT                   /protein_id="ACP24063.1"
FT                   /translation="MSDDQDKDSKTEAPSEKKLSDAAEKGNVPFSREVTAFASTLAVYI
FT                   FIVFFLSDGAASTAEALKDIFEQPEAWRLETATDAVGLISHVVLKSAGLVLPVFVLLII
FT                   FGVGSSIFQNLPRPVLDRIMPNMNRVSPIAGFKRIFGVPGLVEFAKSLFKIIVVSIIVV
FT                   LVLWNDYFATLDLMFSDPVTIFATMISDLKQIVTVVLLATAVLAIVDLFWTRHHWYSEL
FT                   KMTKQEVKEELKQSQGDPIVKSRLRSMQRDRARKRMIASVPRATLVIANPTHYAVALRY
FT                   VREESDAPVVVAMGQDLVALKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYK
FT                   AVAELIHRVYAAQPQQKRVT"
     atgtcggacg atcaggacaa ggacagtaaa accgaagcgc catcggagaa gaaactctcc        60
     gacgcggccg agaaggggaa tgtccccttt tctcgcgaag tgaccgcctt cgcctcgacg       120
     ctcgcggtct acatcttcat cgtcttcttt ctttccgacg gcgcggccag cacggccgag       180
     gcactcaagg acatattcga gcaaccggag gcctggcgcc tcgaaacggc aacggatgcg       240
     gtcgggctga tctcgcacgt cgtactgaag tccgcaggat tggtcctccc tgttttcgtg       300
     ctgctgatca tcttcggcgt cgggtcgtcg atcttccaga atttgccgcg gccggtgctc       360
     gaccggatca tgccgaacat gaaccgcgtc tcgccgatag caggcttcaa gcgtattttc       420
     ggcgttccgg ggctggtgga gttcgccaag tcgctgttca agatcatcgt cgtgtcgatc       480
     atcgtcgtcc tggttctctg gaacgattat ttcgccacgc tcgacctgat gttttcagat       540
     ccggtgacca tcttcgccac gatgatctcc gacctcaagc agatcgtcac cgtcgtgctg       600
     cttgccaccg cggtgctggc gatcgtcgat ctcttctgga cccgtcatca ttggtacagc       660
     gaattgaaga tgacgaagca ggaggtgaag gaggaactga aacagtccca gggcgacccg       720
     atcgtcaagt cgcggcttcg gtccatgcag cgcgaccggg ctcgcaaacg catgatagcc       780
     tccgtgcccc gcgccactct ggtgatcgcc aacccgacgc actacgcggt cgcgctgcgc       840
     tacgtgcgcg aagagagcga cgcgcccgtc gtcgtcgcca tgggacagga tctggtggcc       900
     ctgaagatcc gcgagatagc cgagaaaaat ggcattcccg tcttcgagga tccgccgctc       960
     gcgcgctcca tgtttgcaca agtctcggtc gatagtgtta ttccaccggt gttttacaag      1020
     gcagtcgccg aactcattca ccgggtttac gcagctcagc cgcaacaaaa acgggtgaca      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page