(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIE

CP001389.FLIE        Location/Qualifiers
FT   CDS_pept        316430..316765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="NGR_c02760"
FT                   /product="predicted flagellar hook-basal body complex
FT                   protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24074"
FT                   /db_xref="GOA:C3MG23"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG23"
FT                   /protein_id="ACP24074.1"
FT                   /translation="MIDAIQSVGAFSNLKEAEGTSLTASTALSLPSAGASAPQSQSFAE
FT                   VLGTMTTDAIRSMKSAEGVSLQAIRGEANTREVVDAVMNAEQSLQTALAIRDKVVTAYL
FT                   EIARMQI"
     atgatcgatg caattcagtc cgtcggcgcg ttttcgaacc tgaaggaggc cgaaggcacc        60
     agcctgaccg cctcgaccgc gctctcgctg ccgagtgcgg gcgcttccgc tccgcaatca       120
     cagagcttcg ccgaagtcct cggcacgatg accacggatg ccatccgctc gatgaaatcg       180
     gccgaaggcg tgtcgctgca ggcgatccgc ggcgaggcga acacgcgtga ggtcgtcgat       240
     gcggtgatga atgcggaaca gtcgctgcag accgcgctcg ccatccgcga caaggtggtc       300
     accgcctatc tcgaaatcgc ccgcatgcag atctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page