(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIF

CP001389.FLIF        Location/Qualifiers
FT   CDS_pept        302190..303869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="NGR_c02610"
FT                   /product="flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24059"
FT                   /db_xref="GOA:C3MG08"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG08"
FT                   /protein_id="ACP24059.1"
FT                   /translation="MNLFDQFSTFTKNLSNLGQSKLIALAVAGIVAIGFVLGAAIYVNK
FT                   PAYETLYVGLERSDVTQISIALAEANLDFEVGSDGGSIQVPVGMTGKARLLLAERGLPS
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSF
FT                   RKAEQTPTASVMIRASATVGRGAASSIRHLVASSVPGLDIDDVTILDSTGQLLASGDDP
FT                   ANSALNQSLGVVQNVQTDLEKKIDNALAPFLGMDNFRTSVTASLNTDAQQIQETVFDPE
FT                   SRVERSTRVIKEEQKSSQQQPDNAATVQQNVPQAAPRGGAGQQSNDEAAKKEEQTNYEI
FT                   NSKTIATVKNSYSIERLSIAVVVNRGRLAAMVGEGADQAKIDAYLQDMQKIVASAAGVD
FT                   TNRGDVVTLNAMDFVETQLLDQAVAGPGVMEMLTRNLGGIINSLAFILVAFLVVWLGMR
FT                   PLARQMGFGGQSGHLEGEGAGLELPDFSPAGASAAGGALMEGFGSDFGFDSTDDLLNIS
FT                   DEGNGFNRRVKEGPERRLARMVEISEERAAKILRKWSLDRAA"
     atgaatctgt tcgatcaatt ctcgacgttc acgaaaaacc tgagcaatct cgggcagagc        60
     aagctgatag cactcgcggt ggccggcatc gtcgcaatcg gcttcgttct cggcgccgcc       120
     atctacgtca acaagccggc ctatgaaacg ctctatgtcg gcctcgagcg cagcgatgtc       180
     acccagatca gcattgcgct tgccgaggcc aatctcgact tcgaggtcgg ctcggatggc       240
     ggcagcatcc aggtgccggt gggcatgacc ggcaaggctc ggctgctctt ggccgagcgc       300
     ggcctgccga gcagcgccaa tgccggttac gaactcttcg acaatgtcgg ctcgctgggg       360
     ctcacttcct tcatgcagga ggtcacccgc gtccgcgcgt tggagggcga gattgcccgc       420
     accatccagc agatttccgg cattgccgcg gcgcgcgttc atatcgtgat gcccgagcgc       480
     ggcagcttcc gcaaggccga gcagacgccg acggcatcgg tgatgatccg cgccagcgcg       540
     acggtcggcc ggggggccgc ttcctccatt cgccatctcg tcgcctcgtc ggtcccgggt       600
     ctcgatatcg acgatgtgac cattctcgat tcgaccggcc agcttctggc ctcgggcgac       660
     gatccggcaa acagcgccct caaccagtcg ctcggcgtgg tgcagaacgt tcagaccgat       720
     ctcgagaaga agatcgacaa cgcgcttgcc cccttcctcg gcatggacaa tttccgcacc       780
     agcgtcaccg cctcgctcaa caccgatgcc cagcagatcc aggagaccgt gttcgatccg       840
     gaatcgcggg tcgagcgctc cacccgcgtc atcaaggaag agcagaaatc cagccagcag       900
     cagccggaca acgccgcgac cgtgcagcag aacgtgccgc aggcggcgcc gcgcggcggt       960
     gcgggccagc agtcgaacga cgaggcggcc aagaaggaag agcagacgaa ttacgagatc      1020
     aacagcaaga cgatcgcgac cgtcaagaac agttattcga tcgaacggct gtcgatcgcc      1080
     gtcgtggtca accgcggccg tctggcggcg atggtcggcg aaggggctga ccaggcaaag      1140
     atcgatgcct atcttcagga catgcagaag atcgtcgcct cggcggctgg cgtcgacacg      1200
     aatcgcggcg acgtcgtcac gctgaatgct atggatttcg tcgagacgca gctgctcgat      1260
     caggcagtgg ccggaccggg cgtcatggag atgctgacgc gcaatctcgg cggcatcatc      1320
     aactcgctgg ctttcatcct cgtcgccttc ctggtcgtct ggctgggcat gcggccgctc      1380
     gcccggcaga tgggcttcgg aggccagtcg ggtcatctcg aaggcgaggg cgccggtctc      1440
     gagctgccgg atttctctcc ggccggcgcc agcgccgcgg gcggggccct catggaaggc      1500
     ttcggttcgg acttcggctt cgacagcacg gacgacctgc tcaatatcag cgacgaaggc      1560
     aatggtttca atcgtcgcgt caaggaaggt ccggagcgcc ggcttgcccg catggtggag      1620
     atcagcgagg agcgcgccgc aaaaatcctc cgcaaatggt cgctcgaccg cgccgcctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page