(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIG

CP001389.FLIG        Location/Qualifiers
FT   CDS_pept        complement(308092..309123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="NGR_c02660"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24064"
FT                   /db_xref="GOA:C3MG13"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG13"
FT                   /protein_id="ACP24064.1"
FT                   /translation="MMDFDGFEAQALATPLSQTEKAAAVLLAMGKSVAGKLLKFFTQSE
FT                   LQAIIAAAQSLRAIPPHELEALVNEFEDLFTEGAGLMDNAKAMESILEEGLTPDEVDGL
FT                   LGRRATFQSYEASIWDRLQECDPAAVAQSLAEEHPQTIAYVLSMMPSSFGAKVLLQLSD
FT                   RLRPDILNRAVNMKSVSPRAASIIEARVIEMIEEMEAERNSPGPAKIAEVMNELEKKQV
FT                   DTLLASLETISTDSAKKVRPKIFLFDDILYMPQRSRVQLFNDVSTDVITMALRGSGPEL
FT                   RESVLASVGARQRRIIESDLAVGDAGINPRDIAIARRSITQEAIRLAASGQLELKEKES
FT                   EAA"
     atgatggatt tcgacggttt cgaagcgcag gcattggcaa caccgctcag tcagacggag        60
     aaggccgccg ccgtgctgct cgccatgggc aaatccgtgg ccggtaaact cttgaaattc       120
     ttcacgcaga gcgaattgca ggccatcatc gccgcggcgc agtcgctgcg cgccatccct       180
     ccccacgaac tcgaggcgct ggtcaacgaa ttcgaggacc tgttcaccga aggcgccggc       240
     ctgatggaca acgccaaggc gatggagagc attctcgagg aaggcctgac cccggacgag       300
     gtcgacggcc tgctcgggcg gcgcgccacc ttccagtcct acgaggcaag catctgggat       360
     cggttgcagg aatgcgatcc ggcagcggtt gcccagtcgc tcgccgagga gcacccgcag       420
     acgattgcct atgtcctctc gatgatgccc tcgagcttcg gggccaaggt gctgctgcag       480
     ctatcggacc gactgcgccc ggacattctc aatcgcgccg tcaacatgaa gagtgtcagc       540
     ccgagggccg cctcgatcat cgaggcgcgc gtcatcgaga tgatcgagga gatggaggcc       600
     gagcgcaatt cgcccggccc ggcgaagatc gccgaggtga tgaacgagct cgagaagaag       660
     caggtcgata cgctgctcgc ctcgctcgaa acgatcagca ccgattccgc caagaaggtc       720
     cggccgaaga tcttcctctt cgacgacatc ctctacatgc cgcagagaag ccgcgtgcaa       780
     ttgttcaacg acgtctcgac cgacgtcatc accatggcgc tcaggggttc gggtccggaa       840
     ctgcgcgaat cagttctcgc ctccgtcggc gcgcgccagc ggcgcataat cgaatcggac       900
     cttgcggtcg gcgatgccgg catcaacccg cgcgacatcg ctatcgcccg ccgctccatc       960
     acgcaggaag cgattcgcct cgccgccagc ggacagctgg agctcaagga aaaggaatcg      1020
     gaagccgctt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page