(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIL

CP001389.FLIL        Location/Qualifiers
FT   CDS_pept        320460..320951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="NGR_c02820"
FT                   /product="putative flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24080"
FT                   /db_xref="GOA:C3MG29"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG29"
FT                   /protein_id="ACP24080.1"
FT                   /translation="MEEIDIKQQKSPSLVMTIAAVAVLTLVAGGGGWLVGIFLAPPPAE
FT                   KAEAVAEVPENATGEEGLPKIATEANGIVQLEPITTNLAYPAENWVRVEVALQFKGVPD
FT                   VALAEEIHQDIIAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSDGRVTNVMFRTFVIQ
FT                   "
     atggaagaaa tcgacatcaa gcaacaaaag tccccgtcgc tggtgatgac catcgccgca        60
     gtcgccgtac tgacgctcgt cgccggcggc ggcggctggc ttgtcggcat atttctggcg       120
     ccgccaccgg ccgagaaggc ggaagcggtg gccgaagtcc ccgagaatgc caccggcgag       180
     gagggccttc cgaagatcgc cacagaagcc aacggtatcg tccagctcga accgatcacc       240
     acgaaccttg cctatccggc ggagaactgg gttcgcgtcg aggtcgcgct gcagttcaag       300
     ggcgtccctg acgtcgcgct cgcggaagaa atccaccagg acatcatcgc ctacctcaag       360
     accgtgtcgc tgcagcaaat ccaggggccg cgcggctttc aatatctccg ggatgacatc       420
     caggaacggg ttgacctgcg ctccgacggg cgcgtaacca atgtgatgtt ccgaaccttc       480
     gtcatccaat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page