(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIM

CP001389.FLIM        Location/Qualifiers
FT   CDS_pept        complement(309804..310751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="NGR_c02680"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24066"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG15"
FT                   /protein_id="ACP24066.1"
FT                   /translation="MNPSTDSNVYAFDKKLLARMTGALGDDKTIGRTALELGHVFSERL
FT                   PEMLKQETGRDIAIGYAGVKMGFRNELIADLGEAVLLSDVSLRNWCAEFQIGCDSPVLI
FT                   ALVEALLGAEPIDIEEPLPRALSKIEIDVAVPVFERIAEAVRMAVDAPGGFEPVVGRPH
FT                   NGAERLPPDPALEDVYAASIDMTFGLGPVLSTFSVIIPQNVLLKTQIVPPGNAGRNESM
FT                   KTDWSEQLEEQIRRSAVTLEARIQLESLTLDTISRLQPGDVIPFHDGQDVRVEVNANGR
FT                   DLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIMS"
     atgaacccga gcaccgattc gaacgtctat gctttcgaca agaaactgct ggcgcgcatg        60
     acgggcgcgc tcggcgacga caagacaatc ggccgcaccg ctctggaact cggccatgtc       120
     ttcagcgaac gcctacccga aatgctcaag caggagaccg ggcgcgacat cgcgatcggc       180
     tatgccggcg tcaagatggg gttcaggaat gaactcatcg ccgatctcgg agaagcggtt       240
     ctgctcagtg acgtatctct ccgcaactgg tgcgccgaat tccagatcgg ctgcgacagc       300
     ccggttctca ttgccctcgt cgaagccctg ctcggcgccg aacccatcga catcgaagag       360
     ccgctgccac gggcgctctc caagatcgag atcgacgtcg cggtgccggt gttcgagagg       420
     atcgccgagg ccgtgcgcat ggcggtggac gcgccgggcg gtttcgagcc ggtggtcgga       480
     cggccgcata acggggccga acgcctgccg cccgaccccg cgctcgagga tgtctatgcc       540
     gcctcgatcg acatgacctt cgggctggga ccggtactct ccaccttctc ggtgatcatc       600
     ccgcaaaacg tactgctcaa gacccagatc gtccctcccg gcaatgccgg acgaaacgaa       660
     agcatgaaga cggattggag cgagcagctc gaggagcaga ttcgccgctc ggccgtgacg       720
     ctggaggcac gcatccagct ggagagcctg acgctcgaca cgatcagccg gctgcaaccg       780
     ggagacgtga tcccgtttca tgacggccag gacgtcaggg tcgaggtcaa cgccaacggt       840
     cgcgatctct atgtctgcga gttcggccga tcggggtcga gatacacggt tcgcgtcaag       900
     gacacgcacg gctccgagca ggacatcctt cgtcacatca tgagttaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page