(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIN

CP001389.FLIN        Location/Qualifiers
FT   CDS_pept        complement(309152..309784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="NGR_c02670"
FT                   /product="predicted flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24065"
FT                   /db_xref="GOA:C3MG14"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG14"
FT                   /protein_id="ACP24065.1"
FT                   /translation="MPEASFNWNNPHMVRKKAASIEEQAAFAGDAELDQAIDDLRGVLK
FT                   QDGAATDFGAEFGAAEPFGQGADFGGGLGAGGFGGDFADTSLDGGLDVGTGFAGSDFGG
FT                   SDFGGGDFGAVSSGIETAPGSGMAANMDLIMDIPIDVQIVLGTSRMQVSGLMGLTEGAT
FT                   IALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLIEIKGSRK"
     atgcctgagg caagcttcaa ctggaataat ccgcacatgg tacgcaagaa agcagcatcc        60
     atcgaagaac aggccgcatt tgcaggagac gccgagctcg atcaggcgat cgacgatctg       120
     cgcggcgttc tcaagcagga cggcgcagca acggatttcg gcgccgagtt cggcgctgcc       180
     gagccgttcg gccagggcgc ggactttggt ggcggcctcg gtgcgggcgg cttcggcggc       240
     gatttcgccg acacctccct ggacggcggc ctcgacgttg gaaccggctt tgccggcagc       300
     gatttcggcg gcagcgattt cggcggcggc gatttcggtg cggtgtcatc cggcatcgag       360
     actgcgccgg gcagcggcat ggcggcaaac atggacctga tcatggacat cccgatcgat       420
     gtccagatcg tgctcggcac gagccggatg caggtctccg gtctcatggg gctgaccgag       480
     ggggcaacga tcgcgctcga ccgcaagatc ggcgagccgg tggagatcat ggtcaacggc       540
     cgggtcatcg gccgcggcga gattaccgtc ctcgagggcg atgtgacccg gttcggcgtc       600
     aagctcatcg agataaaggg cagcaggaaa tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page