(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIP

CP001389.FLIP        Location/Qualifiers
FT   CDS_pept        321007..321744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="NGR_c02830"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24081"
FT                   /db_xref="GOA:C3MG30"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG30"
FT                   /protein_id="ACP24081.1"
FT                   /translation="MLRIAAFIVAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTFG
FT                   LLTVLSVAPGILIMVTSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTF
FT                   DRAWREGIDPLLKNEISETEALPRVSEPFREFMLANTRDKDLQLFIDIAREKGQTVVVD
FT                   DKVDLRAVVPAFMISEIRRGFEIGFLIMLPFLVIDLIVSTITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFT"
     atgctccgga ttgctgcctt catagtcgcc atgatggcga tgtcgggaat tgccggggcg        60
     cagagctttc ccgccgatat tctgaacacg ccggtcgatg gttcggtcgc ctcctggatc       120
     atccgcacat tcgggctgtt gaccgtcctt tcggtcgccc cgggcatcct gatcatggtg       180
     acgagctttc cccgtttcgt catcgccttt gcgatcctgc gctcgggcat ggggcttgcg       240
     accacaccgt cgaacatgat catggtgtcg ctggcgctgt tcatgacctt ctacgtgatg       300
     gcgcccacct tcgaccgcgc ctggcgcgag ggcatcgatc cgctgttgaa gaacgagatt       360
     tccgagaccg aggcgctgcc gcgggtatcc gagccgttcc gtgagttcat gctcgccaac       420
     acgcgcgaca aggacctgca gctcttcatc gacatcgccc gcgagaaggg ccagaccgtc       480
     gtcgtcgacg acaaggtcga tctgcgcgcc gtcgtgccgg ccttcatgat ttcggagatc       540
     cgccgcggct tcgagatcgg cttcctgatc atgctgccct tcctggtcat cgatctcatc       600
     gtctcgacca tcaccatggc gatgggcatg atgatgctgc cgccgacgtc gatctcgctg       660
     cccttcaaga tcctgttctt cgtgctgatc gacggctgga acctgctcgt cggcagtctg       720
     gtgcgctcct tcacttaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page