(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIQ

CP001389.FLIQ        Location/Qualifiers
FT   CDS_pept        338286..338552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="NGR_c03000"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24098"
FT                   /db_xref="GOA:C3MG47"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG47"
FT                   /protein_id="ACP24098.1"
FT                   /translation="MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVVIAFIQALTQVQ
FT                   EMTLTFVPKILAVMVTAAISAPFVGAQISIFTDIIFSRIQSGF"
     atgaatgagg cggacgccct cgacatcgtg caggccgcga tctggaccgt gatcgtcgcc        60
     tcgggtcccg ccgtcctggc ggcgatggtg gtcggcgtcg tcatcgcctt catccaggcg       120
     ctgacccagg ttcaggaaat gacgctgacc ttcgtgccga agatcctggc ggtaatggtc       180
     actgcggcga tctcggcacc gttcgtcggt gcgcagatct ccatcttcac cgatatcatc       240
     ttttcaagaa tccagtccgg cttctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page