(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIR

CP001389.FLIR        Location/Qualifiers
FT   CDS_pept        340750..341502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="NGR_c03020"
FT                   /product="flagellar biosynthesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24100"
FT                   /db_xref="GOA:C3MG49"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG49"
FT                   /protein_id="ACP24100.1"
FT                   /translation="MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQVRLFIAVA
FT                   LSMAILPIMWTDIYPQVAGKGHTYIYLIATESVIGAVIGLVARYYVLGLQFAGTAITML
FT                   IGFNPPPATDVLEETAENQLTSMISFAGLMLLFMLDFHHVIFEAIAQSYRVMPIGIGFD
FT                   PQGMLITLTNSLGQTFLIMLRLASPFVIYGLLFNVAIGMVNRLAPQVPVYFISQPYLIL
FT                   GGLFLLYLGIAAMLRLFADGFAPVMQGG"
     atgatcacag atcccgaggg cacggtgctg gcgctttttg cggcattctg ccggatcggc        60
     ggttgcatca tgatcatgcc gggattttcg accgcgcgcg tcccgatgca ggtacggctg       120
     ttcatcgccg tcgcgctttc catggccatc ctgccgatca tgtggaccga catctatccg       180
     caggtcgcgg gcaagggcca cacctacatc tatctcatcg cgaccgagag cgtgatcggc       240
     gccgtcatcg gcctcgtggc ccgctactac gtgcttggcc tgcaattcgc cgggacggcg       300
     atcaccatgc tgatcggctt caacccgccg ccggcgaccg acgtgcttga agagacggcg       360
     gaaaaccagc tcaccagcat gatcagcttc gccggcctga tgcttctctt catgctcgac       420
     ttccaccatg tgatcttcga ggccatcgcg cagtcctacc gcgtcatgcc gatcggcatc       480
     ggcttcgatc cgcagggcat gctgatcacg ctcacgaact cgctcggaca gacctttctg       540
     atcatgctgc gccttgcgag tcccttcgtc atctatggcc tgctcttcaa cgtggcgatc       600
     ggcatggtga acaggcttgc gccgcaggtt ccggtctatt tcatctccca gccctatctc       660
     atcctgggcg gcctgttcct gctctatctg gggattgccg cgatgctccg cctgttcgcc       720
     gatggtttcg cgccggtgat gcaagggggg taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page