(data stored in ACNUC7421 zone)

EMBL: CP001389.FOLD2

CP001389.FOLD2       Location/Qualifiers
FT   CDS_pept        345059..345958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD2"
FT                   /locus_tag="NGR_c03080"
FT                   /product="bifunctional protein FolD2; includes:
FT                   Methylenetetrahydrofolatedehydrogenase ;
FT                   Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24106"
FT                   /db_xref="GOA:C3MGJ1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ1"
FT                   /protein_id="ACP24106.1"
FT                   /translation="MTTVIDGKAVAASVIETVKSATQTLETETGVRAGLAVVIVGDDPA
FT                   SHAYVSAKSRMAKECGFLSVQHTLPGETSQEELAALVAELNADPSIHGILVQLPLPKHL
FT                   QSEPIIQSILPEKDVDGLHVVNAGKVATGDLDGGLVSCTPAGAMVFVRRTHGGDLSGLN
FT                   AVVIGRSNLFGKPMSALLLAANATVTTAHSRTKDLAAVCRNADILVAAVGRPEMVKADW
FT                   VKPGALVIDVGINRVAAPERGEGRTKLVGDVAFEECAKVASVITPVPGGVGPMTIAMLM
FT                   ANTIIAAYRKAGQNPPKF"
     gtgacgactg tgattgatgg caaggctgta gccgcttcgg tcatcgaaac cgtgaaatca        60
     gctacccaga cgctggagac ggaaacaggc gtccgggccg gcctggcggt agtcattgtc       120
     ggcgacgatc cggcaagcca cgcctatgtg tcggcgaaaa gccggatggc caaggaatgc       180
     ggtttcctct cggtccagca caccctgccg ggagagacct cgcaggaaga actggcggcc       240
     ctggtcgcgg agctcaatgc cgatccttcc atccacggca ttctcgtcca attgcctctg       300
     ccgaagcatc ttcagtcgga gccgatcatc caatcgatcc tgcccgagaa ggatgtcgac       360
     ggactgcatg tcgtcaatgc cggcaaggtc gcgaccggcg atctcgacgg cggactggtc       420
     tcctgcaccc cggccggcgc catggtcttc gtgcgccgca cccatggtgg cgatctttcc       480
     gggttgaatg ccgtcgtcat cggtcgctcc aatctcttcg gcaagccgat gtcggcgctg       540
     ctgctcgctg ccaatgcgac ggtcaccact gcgcattcgc gcaccaagga tcttgcggcc       600
     gtgtgccgca acgccgatat cctcgtggcg gcggtcggcc gcccggaaat ggtcaaggcg       660
     gactgggtca agcccggtgc gctggtcatc gatgtcggca tcaaccgcgt cgcggcgccg       720
     gagcgcggcg agggcaggac gaagctcgtc ggcgacgtcg ccttcgagga atgcgccaag       780
     gttgcaagcg tcatcacgcc ggtgccgggc ggcgtcgggc cgatgacgat cgccatgctg       840
     atggcgaaca cgatcatcgc cgcctatcgc aaagccgggc aaaacccgcc gaagttctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page