(data stored in ACNUC7421 zone)

EMBL: CP001389.FTSJ

CP001389.FTSJ        Location/Qualifiers
FT   CDS_pept        417309..418046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="NGR_c03730"
FT                   /product="putative ribosomal RNA large subunit
FT                   methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24169"
FT                   /db_xref="GOA:C3MGQ4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGQ4"
FT                   /protein_id="ACP24169.1"
FT                   /translation="MTKSPIGGNRSGRKLGQKVKKGKLKASSRRWLERHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHKILAGARRIIDLGAAPGSWSQIAAKVTNSTDADPRVAAID
FT                   FLEMDPIPGVRFLQLDFLDPEAPEKLKEAIGGTPDLVLSDMAAPTTGHRQTDHLRTMHL
FT                   CEVAAHFAVDVLAKGGHFLAKTFQGGTERDLLNMLKQNFSQVIHVKPASSRTESVEMFL
FT                   LAKGFKGRRKAETEEPAEDAAAE"
     atgacgaaat ccccgatcgg cggcaaccgc agcggccgca agctcggcca gaaggtcaag        60
     aagggcaagc tcaaggcgtc gtcgcgccgc tggctggagc ggcacatcaa cgatccctac       120
     gtgcagcgcg cccagctcga aggctatcgc gcccgggcgg ccttcaagct gctggagatc       180
     gacgagaagc acaagattct cgccggcgcc cgccgcatca tcgatctcgg cgccgcaccc       240
     ggaagctggt cgcagatcgc cgccaaggtg acgaactcga ccgacgcgga cccgcgtgtg       300
     gcggcgatcg actttctcga gatggacccg atcccgggcg tccgcttcct gcagctggat       360
     ttcctcgatc ctgaggcgcc ggaaaagctg aaggaagcga tcggcgggac gcccgacctc       420
     gtcctctccg acatggcggc gccgaccacc ggccaccgcc agaccgacca tctgcgcacc       480
     atgcatctct gcgaggtggc ggcgcatttc gccgtcgacg tgctggccaa gggcgggcac       540
     tttctcgcaa aaaccttcca gggcggcacg gaacgcgacc ttctcaacat gctgaagcag       600
     aatttcagcc aggtcatcca cgtgaagccc gcctcgtcgc gcaccgaatc ggtcgagatg       660
     ttcctgctcg ccaaggggtt caaggggcgc cggaaggctg aaaccgaaga gccggcggaa       720
     gacgccgcgg cggagtag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page