(data stored in ACNUC7421 zone)

EMBL: CP001389.GALE

CP001389.GALE        Location/Qualifiers
FT   CDS_pept        212379..213413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="NGR_c01880"
FT                   /product="UDP-glucose 4-epimerase protein"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23988"
FT                   /db_xref="GOA:C3MFT7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT7"
FT                   /protein_id="ACP23988.1"
FT                   /translation="MAILVTGGAGYIGSHMVWSLLDAGETVVVLDSLTTGFRWAVAPEA
FT                   RFYFGDVGDRAVLARIFAENEIDAVVHFAGSAVVPESVAKPLAYYENNTAKTRMLIAAT
FT                   IEAGVRRFVFSSTAAVYGTQDTPEPVKETAWLRPESPYGRSKLMSEIMLQDAAAAHDFS
FT                   YVALRYFNVAGADPLGRAGQSTFGATHLIKVACEAALGKRRKVDVFGTDYPTADGTGIR
FT                   DYIHVSDLVAAHRNALDYLRRGGEPLVTNCGYGEGFSVLQVLDTVRQVSGCDFRVDYAP
FT                   RRPGDAAQVVADPTVARLKLDWVPTHASLEHIVQSAFDWEGYLSRKNSFDAGRSEDGRL
FT                   VANG"
     atggccatat tggtaacagg cggagcgggc tatatcggca gccatatggt ttggtcattg        60
     ctcgacgcgg gagagaccgt cgtcgtgctc gacagcctga cgaccggctt ccgttgggcg       120
     gttgcgccgg aggcgcgttt ctatttcggc gatgtcggcg accgggccgt gctggcgcgg       180
     atattcgccg agaacgagat cgacgcggtc gtccattttg ccggatcggc ggtcgtgccg       240
     gagtccgtcg ccaagccgct cgcctactac gagaacaata cggcaaagac gcggatgctg       300
     attgccgcga cgatcgaagc cggtgtgcgc cgtttcgtct tctcttcgac ggccgccgtc       360
     tatgggaccc aggatacgcc ggagccggtc aaggaaacgg cgtggctgcg tccggaaagc       420
     ccctatgggc gttccaagct gatgtcggag atcatgctgc aggatgcggc ggccgcgcat       480
     gacttcagct atgtcgcgct tcgctatttc aatgtggccg gggccgatcc tctcggtcgt       540
     gccggacaat cgaccttcgg cgccacccat ctcatcaagg tcgcctgcga ggcggcactc       600
     ggcaagcgcc gcaaggtcga cgtgttcggc accgactatc cgacagcgga tggcaccggc       660
     atccgcgact acatccatgt cagcgatctg gtcgccgccc atcggaacgc gcttgattat       720
     ctaaggcgcg gcggtgagcc gctcgtcacc aattgcggct atggcgaagg cttttccgtg       780
     ttgcaggtgc tcgacacggt ccggcaggtt tccggctgcg atttccgcgt cgattatgcg       840
     ccgcgccgcc cgggcgatgc ggcccaggtc gtcgccgatc cgaccgtcgc gcggttgaag       900
     ctcgactggg tcccgaccca tgcgagcctc gaacatatcg tccagagcgc cttcgattgg       960
     gaagggtatc tgagccgcaa gaacagtttc gacgccggtc gcagcgaaga cggacgcctt      1020
     gtcgccaacg gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page