(data stored in ACNUC7421 zone)

EMBL: CP001389.GLCD2

CP001389.GLCD2       Location/Qualifiers
FT   CDS_pept        438119..439558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD2"
FT                   /locus_tag="NGR_c03920"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24188"
FT                   /db_xref="GOA:C3MGS3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS3"
FT                   /protein_id="ACP24188.1"
FT                   /translation="MPETIGFLKPRQAVLDRRPEIIADLADLLPEGCLISDERGLKPFE
FT                   TDAFLAYRRLPLAVVLPETTEQVSAVLKYCSRYGIPVVPRGAGTSLSGGAIPQEDAIVI
FT                   GLSKMSRILDVDLFNRTATVQAGVTNLNISDAVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVKMVLFDGTVIELGGKALDSSGYDLLGLVCGSEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFASSVAAGSCVADIIGSGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVEALLIVEVEGSEAEMDTMLESIIAIARRHGVMTIKESQSALEAALIWKGRKSA
FT                   FGATGRVADYICMDGTVPLSQLSHVLRRTGEIVASYGLRVANVFHAGDGNMHPLILYNI
FT                   NDPEDAARAEAAGNDILKLCVDAGGCLTGEHGVGIEKRDLMRHQYNKADLDQQMAVRAA
FT                   FDPQWLLNPSKVFPLEGRPAA"
     atgccggaga cgatcggatt cctgaaaccc aggcaggccg tcctcgaccg ccggccggag        60
     atcattgccg acctcgccga cctcctgccg gagggttgcc tgatcagcga cgaacgcggg       120
     ctgaagccct tcgagacgga cgcatttctc gcctatcgcc gcctgccgct cgccgttgtg       180
     ctcccggaga cgaccgagca ggtctccgcg gtcctcaaat attgcagtcg ctacggcatc       240
     ccggtcgtgc cgcgcggggc cggcacgtcg ctctccggcg gcgccatccc gcaggaagac       300
     gcgatcgtca tcggtctctc gaagatgtcg cgcattctcg atgtcgatct cttcaaccgg       360
     acggcgacgg tccaggcggg ggtcaccaat ctcaacattt ccgacgcggt gagcgccgac       420
     ggcttcttct acgcccccga tccgagctcc cagctcgcct gcacgatcgg cggcaacatc       480
     ggcatgaatt ccggcggcgc ccactgcctg aaatacggcg tcacgaccaa caacctcctg       540
     ggcgtcaaga tggtgctctt cgacggcacg gtgatcgagc tcggcggcaa ggcgctggat       600
     tcgtccggct acgatctgct cggcctcgtc tgcggctcgg aaggccagct cggcatcgtc       660
     accgaggcga cggtgcggct gatcgccaag ccggaagggg cgcgccccgt attgttcggc       720
     ttcgcctcgt cggtcgcggc cggttcctgc gtcgccgata tcatcgggtc gggcatcatc       780
     ccagtggcga tcgagttcat ggacaagccg gcgatcgaga tctgcgaggc ctttgcccat       840
     gccggctatc cgctcgacgt tgaggcgctg ctgattgtcg aggtcgaggg gtcggaggcg       900
     gagatggaca cgatgcttga gagcatcatc gcgatcgccc gccgtcacgg cgtcatgacg       960
     atcaaggaat cgcagtcggc gctcgaggcg gcgctgatct ggaaaggccg gaaatccgcc      1020
     ttcggtgcca ccgggcgggt cgccgactat atttgcatgg acggcacggt gccgctcagc      1080
     cagctctccc atgtgttgcg tcggaccggc gagatcgtcg cgagctacgg gctccgcgtc      1140
     gccaacgtct tccatgccgg cgacggcaat atgcatccgc tgatcctcta caacatcaac      1200
     gatccggagg atgcggcccg cgctgaagcg gccggcaacg acatcctgaa gctctgcgtc      1260
     gatgcgggcg gctgcctgac gggcgagcac ggtgtcggca tcgaaaagcg ggatctgatg      1320
     cggcatcagt acaacaaggc cgacctcgac cagcagatgg ccgtgcgcgc cgccttcgat      1380
     ccgcaatggc ttttgaaccc gtcgaaggta tttccgctcg aaggacggcc tgcggcatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page