(data stored in ACNUC7421 zone)

EMBL: CP001389.GLCE2

CP001389.GLCE2       Location/Qualifiers
FT   CDS_pept        439555..440766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE2"
FT                   /locus_tag="NGR_c03930"
FT                   /product="glycolate oxidase, subunit GlcE"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24189"
FT                   /db_xref="GOA:C3MGS4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS4"
FT                   /protein_id="ACP24189.1"
FT                   /translation="MIVHFEPASEEGIASVVRSAAAERVTLAIVGGGTRSGLGNPVRAD
FT                   RTLSTRRLAGIVAYHPAEMTMSALAGTPLAEVEAALAANGQMLSFEPMDHRPIFGTTGE
FT                   PTIGGVFAANVSGPRRYVAGAARDNLLGVRFVNGRGELIKAGGRVMKNVTGLDLVKLMA
FT                   GSYGTLGILTEVTFKVLPVPPAAATVVVSGLNDAEAAAVMAEAMAQPVEVSGAAHLPES
FT                   VRGRFIDGALPEGAATVLRLEGLAASVEMRAEKLVAALSRFGSRSQLDAGQAKALWAEI
FT                   RNVKPYADGTARPLWRVSVAPSAGHQLVAALRLQTGVDAFYDWQGGLVWLRMEAEAEAE
FT                   LVRRYVGALGGGHATLVRADGEARARAPAFEPQAPAVAQLSERVRATLDPARIFNPGRL
FT                   AAVA"
     atgatcgtcc atttcgaacc ggcaagcgaa gaagggatcg cctcggtggt gcgctccgcg        60
     gcggccgagc gagtcacgct tgccatcgtc ggcgggggga cgcgctctgg tctcgggaat       120
     ccggtgcggg ccgaccgaac gctttcgacg cggcgcctcg ccggcatcgt cgcctaccat       180
     ccggcggaga tgaccatgag cgcgcttgcc gggacaccgc ttgccgaggt ggaagcggcc       240
     ctcgccgcca acggccagat gctgtcattc gagcccatgg atcaccgtcc gatcttcgga       300
     acgacgggcg agccgacgat cggcggggtt ttcgcggcga atgtctccgg gcctcgccgc       360
     tatgttgccg gagccgcccg cgacaacctg ctcggcgtgc gtttcgtcaa tggccgcggc       420
     gaactgatca aggctggcgg tcgtgtcatg aagaacgtca ccgggctcga tctcgtcaag       480
     ctgatggcgg gctcctacgg gacgctcgga attctgacgg aagttacatt caaggtgttg       540
     ccagttccgc cggctgccgc gaccgttgtc gtctcgggtc tcaacgatgc ggaggccgcg       600
     gcggtgatgg ccgaggcgat ggcccagccg gtggaggtat cgggcgcggc gcatctgccg       660
     gaaagcgtgc ggggccgctt catcgacggc gcgctgccgg aaggggcggc gaccgtgttg       720
     aggctcgaag gcttggcggc gtcggtcgag atgcgtgccg aaaagctcgt cgcggcgctg       780
     tcgcgcttcg gttcgcgctc gcaactggac gccgggcagg ccaaggccct ctgggccgag       840
     atccgcaacg tgaagcctta tgccgatggc actgcgagac ccttgtggcg tgtctcggtc       900
     gccccgtccg cgggtcatca gctcgttgca gcgctgcgtc ttcagacggg cgtggatgca       960
     ttctacgatt ggcagggcgg tcttgtctgg cttcgcatgg aggcggaagc cgaggctgaa      1020
     ctcgtacggc gctatgttgg cgccttgggc ggaggccatg cgacgcttgt gcgcgccgac      1080
     ggcgaagcgc gggcccgagc cccggccttc gagccgcagg ctccggccgt ggcgcaactg      1140
     agcgaacgcg tgcgtgccac cctcgatccg gcgcgcatct tcaacccggg gcggttggcg      1200
     gcagtcgcct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page