(data stored in ACNUC7421 zone)

EMBL: CP001389.GLND

CP001389.GLND        Location/Qualifiers
FT   CDS_pept        33204..36101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="NGR_c00320"
FT                   /product="[Protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23836"
FT                   /db_xref="GOA:C3MEZ9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ9"
FT                   /protein_id="ACP23836.1"
FT                   /translation="MQRTIRSVGQDASRHFMARHETSFPEILDVAALRAKCGFIAAAHA
FT                   EQREPMRRALLAAFKEANNAGRAKARQLLAADGAGIKCAERISWLQDQLITVLHDFMLN
FT                   EVFDAAHAPPAARLAVTAVGGYGRGTLAPGSDIDLLFLLPSKRAVWAEPAIEFMLYVLW
FT                   DLGFKVGHATRTIDECIRLSRADMTIRTAILECRYICGSEALAGELEQRFDHEIVRNTG
FT                   PEFIAAKLAERDGRHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWIAKYFYRVKDPADLV
FT                   KLAVLSRQEYKLFQKSDDFLWAVRCHMHFLTGKAEERLSFDIQREIAEALGYHDHPGLS
FT                   AVERFMKHYFLVAKDVGDLTRIFCAALEDQQAKDTPGISGVFSRFKHRTRKIAGTLDFV
FT                   DDGGRIALASPDVFKREPINLLRLFHIADIHGLEFHPNALKQVTRSLGLITPHLRENDE
FT                   ANRLFLSILTSRRNPELILRRMNEAGVLGRFIPDFGKIVSMMQFNMYHHYTVDEHLLRT
FT                   VDVLSRIDRGLEEEAHPLTAMLMPGIEDRSALYVAVLLHDIAKGRPEDHSVAGAKVARK
FT                   LCPRLGLSPKQTETVVWLVEEHLTMSMVAQTRDLNDRKTILDFAERVQSLDRLKMLLIL
FT                   TVCDIRAVGPGVWNGWKGQLLRTLYYETELLLSGGFSELSRKERAKHAAHMLSDALKDW
FT                   SKKERDAYVRLHYQPYLLTVALEDQVRHAEFIREADRAGKTLATMVRTHHFHAITEITV
FT                   LSPDHPRLLTVIAGACAAAGANIVDAQIHTTSDGRALDTILVNREFSVDEDEMRRAASI
FT                   GKLIEDVLSGRKRLPEVIASRTRAKKRSKAFTVTPEVTISNTLSNKFTVIEVEGLDRTG
FT                   LLSEITAVLSDLSLDIASAHITTFGEKVIDTFYVTDLVGAKITNENRQGNIAARLKAVL
FT                   AGEVDEARERMPSGIIAPAHSPRSSHAARTTKVET"
     atgcagcgaa ccatacgatc agtcggacag gacgcctccc ggcactttat ggccagacac        60
     gaaacttcct tccccgaaat tctcgacgtc gccgcgctgc gggcgaaatg cggcttcatc       120
     gccgcggccc atgccgagca gcgcgaaccg atgcgccgcg cccttctcgc cgccttcaag       180
     gaggcgaaca acgccggccg cgccaaggca cgccaactgc ttgccgccga cggcgctggc       240
     atcaaatgcg ccgagcgcat ttcctggctg caggaccagc tcatcacggt gctgcacgat       300
     ttcatgctga acgaggtctt cgacgcggcc catgcgccgc cggcggcccg gctcgcggtg       360
     accgcggtcg gcggctacgg ccgcggcacg ctggcgccgg gctcggacat cgacctgctc       420
     ttcctgctgc cgtccaagag ggcggtctgg gccgaacccg ccatcgagtt catgctctat       480
     gtcctgtggg atctcggctt caaggtcggc catgcgacca ggaccatcga cgaatgcatc       540
     cgcctgtcgc gcgccgacat gacgatacgc acggcaatcc tcgaatgccg ctatatttgc       600
     ggctccgagg cattggcggg cgaactggaa cagcgtttcg atcacgagat cgtccgcaac       660
     accggccccg aattcatcgc tgccaagctc gccgaacggg acgggcgcca ccgcaaggcc       720
     ggcgacaccc gctacctcgt cgagccgaac gtcaaggaag gcaagggggg cttgcgcgat       780
     ctgcacacgc tgttctggat cgccaagtat ttctaccggg tcaaggatcc ggccgacctc       840
     gtcaagctcg ccgtcctgtc gcggcaggaa tacaagctct tccagaagtc ggacgatttc       900
     ctctgggcag tgcgctgcca catgcatttc ctgaccggaa aggcggagga gcggctgtcc       960
     ttcgacatcc agcgcgagat tgccgaagcg ctcggctatc acgaccatcc gggtctctcg      1020
     gcggtcgaac gcttcatgaa gcattatttc ctcgtcgcca aggatgtcgg cgatctcacc      1080
     cgcatcttct gcgcggcgct cgaagaccag caggccaagg acacgcccgg gatttccggc      1140
     gtcttcagcc gcttcaagca ccgcacccgc aagatcgccg gcacgctcga cttcgtcgac      1200
     gatggcgggc gcatcgcgct cgccagcccg gacgtcttca agcgcgagcc gatcaacctg      1260
     ctgcggctgt tccacatcgc cgatatccac ggcctggaat tccatccgaa cgcgctgaag      1320
     caggtgacgc ggtcgctcgg cctgatcacg ccgcatctgc gcgagaacga cgaggccaac      1380
     cggctcttcc tgtcgatcct gacctcccgg cgcaatccgg aactgatcct gcggcggatg      1440
     aacgaggcgg gcgtgctcgg ccgcttcatt ccggatttcg gcaagatcgt ctcgatgatg      1500
     cagttcaaca tgtaccacca ctacacggtg gacgagcacc tgctgcgcac ggtcgacgtt      1560
     ctgtcccgga tcgatcgcgg ccttgaggag gaggcacatc cgctgacggc gatgctgatg      1620
     cccggcatcg aggaccgctc ggcgctctat gtcgcggtgc tgctgcacga catcgccaag      1680
     ggccgccccg aggaccattc ggtcgccggc gccaaggtgg cccgcaagct ctgcccgcgc      1740
     ctcggcctgt cgccgaagca gacggaaacc gtcgtctggc tggtcgagga gcatttgacc      1800
     atgtcgatgg ttgcacagac ccgtgacctc aacgatcgca agaccatcct cgatttcgcc      1860
     gaacgggtgc aatcgctcga tcgcctgaag atgctgctca tcctgaccgt ctgcgacatc      1920
     cgggccgtcg ggccgggcgt ctggaacggc tggaagggcc agttgctgcg cacgctctac      1980
     tacgagacgg aactgcttct ctccggcggc ttctcggaac tgtcgcgcaa ggagcgggcg      2040
     aagcacgccg cccatatgct gagcgacgcg ctgaaggact ggtcgaagaa ggagcgggac      2100
     gcctatgtcc ggctgcacta ccagccctat ctcctcaccg tggcgctcga ggaccaggtg      2160
     cgccacgccg aattcatccg cgaggcggac cgcgccggta agaccctggc gacaatggtg      2220
     cgcacccatc atttccacgc catcaccgag atcaccgtgc tttcgccgga ccatccgcgc      2280
     ctgctgacgg tcatcgccgg cgcctgcgcg gcggcgggcg ccaacatcgt cgatgcgcag      2340
     atccatacga cctcggacgg ccgggcgctg gatacgatcc tcgtcaaccg cgagttctcg      2400
     gtcgacgagg acgagatgcg gcgggcggcg agcatcggca agctgatcga ggacgtgctc      2460
     tccggccgca agcgcctgcc ggaggtgatc gccagccgca cccgggcgaa gaagcgcagc      2520
     aaggccttca ccgtgacgcc cgaggtgacg atcagcaaca cgctgtcgaa caagttcacc      2580
     gtcatcgagg tcgagggcct cgaccggacg ggtctgcttt ccgagatcac cgcggtgctc      2640
     tcggacctgt cgctcgacat cgcctcggcc catatcacca ccttcggcga gaaggtgatc      2700
     gacaccttct acgtcaccga tctcgtcggc gcgaagatca ccaacgagaa ccggcagggc      2760
     aatatcgccg cgcgcctgaa ggcggtgctg gcgggcgagg tcgacgaggc gcgcgagcgc      2820
     atgccctccg gcatcatcgc gccggcccat tcgccgcggt cgtcgcacgc tgccagaacg      2880
     acaaaagtcg aaacatga                                                    2898
//

If you have problems or comments...

PBIL Back to PBIL home page