(data stored in ACNUC7421 zone)

EMBL: CP001389.GROEL1

CP001389.GROEL1      Location/Qualifiers
FT   CDS_pept        complement(456136..457773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL1"
FT                   /locus_tag="NGR_c04080"
FT                   /product="60 kDa chaperonin 2"
FT                   /note="protein Cpn60 2; GroEL protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24204"
FT                   /db_xref="GOA:C3MGT9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT9"
FT                   /protein_id="ACP24204.1"
FT                   /translation="MAAKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGA
FT                   KAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILL
FT                   HEKKLSNLQAMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLENVTLDMLGRAKKVSISKENTTIVDGAGQKA
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGVALLRSSVKITAKGENDDQDAGVNIVRRALQAPARQIAENAG
FT                   DEASIVVGKILEKNTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITT
FT                   EAMIAELPKKDAPAMPGGMGGMGGMDMM"
     atggcagcta aagaagtcaa gttcggccgc accgcgcgcg aaaagatgct gcgcggcgtc        60
     gacatcctcg ccgatgcagt caaggtaacg ctcggcccga agggtcgtaa cgtcgttatc       120
     gacaagtcct tcggcgctcc gcgcatcacc aaggacggcg tttcggtcgc caaggaaatc       180
     gaactcgaag acaagttcga gaacatgggc gcccagatgg tccgcgaagt cgcttcgaag       240
     accaacgaca tcgccggcga cggcacgacg acggcaaccg ttctcgccca ggcgatcgtt       300
     cgcgaaggcg ccaaggccgt tgccgccggc atgaacccga tggacctgaa gcgcggcatc       360
     gaccttgccg tcgccgaagt cgtcaaggac ctgctcgcca aggccaagaa gatcaacacc       420
     tcggacgaag ttgcccaggt cggcacgatc tcggcaaacg gcgaaaagca gatcggcctc       480
     gacattgcag aagcaatgca gaaggtcggc aacgaaggcg tcatcacggt tgaagaagcc       540
     aagaccgccg agaccgagct cgaagtcgtc gaaggcatgc agttcgaccg cggctacctg       600
     tcgccctact tcgtcaccaa cccggaaaag atggtcgccg atctcgaaga cgctttcatt       660
     ctcctgcacg agaagaagct ctcgaacctc caggcgatgc tcccggttct cgaagccgtc       720
     gtccagaccg gcaagccgct cctcatcatc gctgaagacg tcgaaggcga agcgctcgct       780
     accctcgtcg tcaacaagct gcgcggcggt ctgaagatcg ctgccgtcaa ggctccgggc       840
     ttcggcgacc gccgcaaggc catgctcgaa gacatcgcca tcctgacggg cggcacggtg       900
     atctccgagg acctcggcat caagctcgaa aacgtcacgc tcgacatgct cggccgtgcg       960
     aagaaggtct cgatctccaa ggaaaacacg acgatcgtcg acggcgccgg ccagaaggcc      1020
     gacatcgaag gccgcgttgc ccagatcaag gcccagatcg aagagaccac ctccgactac      1080
     gaccgcgaga agctgcagga acgccttgcc aagctcgccg gcggcgttgc cgtcatccgc      1140
     gtcggcggtg cgacggaaat cgaagtgaag gaaaagaagg accgcatcga cgacgccctc      1200
     aacgcgacgc gcgctgccgt tcaggaaggc atcgtaccgg gcggcggcgt cgctctgctg      1260
     cgctcctccg tcaagatcac cgccaagggc gaaaacgacg accaggacgc cggcgtcaac      1320
     atcgttcgcc gcgctctgca ggctccggcc cgccagatcg ctgaaaacgc tggtgatgaa      1380
     gcctcgatcg ttgtcggcaa gatcctcgag aagaacaccg acgacttcgg ctacaacgct      1440
     cagaccggtg aatatggcga catgatcgcc atgggcatca tcgacccggt caaggtcgtt      1500
     cgcaccgccc tgcaggacgc agcctcggtt gcttcgctgc tgatcaccac cgaagccatg      1560
     atcgccgagc tgccgaagaa ggacgctccg gcaatgccgg gcggcatggg cggcatgggc      1620
     ggcatggaca tgatgtga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page