(data stored in ACNUC7421 zone)

EMBL: CP001389.GRPE

CP001389.GRPE        Location/Qualifiers
FT   CDS_pept        10288..10956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="NGR_c00120"
FT                   /product="GrpE protein"
FT                   /note="nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23816"
FT                   /db_xref="GOA:C3MEJ3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ3"
FT                   /protein_id="ACP23816.1"
FT                   /translation="MMPNTPKTRHSENVMTDETNKNGTEAAAPEEIVKATGPEAAEKPE
FT                   AGASAAGPDPLELAKAESADLRDKYLRLAAEMDNLRRRTERDVKDAKSYSVAGFARDML
FT                   AVSDNLRRALEAIPAEARESGDAGLTALIEGVEMTERSMLAALERHGVKQLDPTGQRFD
FT                   PNFHQAMFEVPNPEVPNNTVVQVVQAGYTIGERVLRPAMVGVAKGGPKIVAAESETPAA
FT                   "
     atgatgccga acacgccaaa gacaagacat tcggagaacg tcatgaccga cgaaacgaac        60
     aagaacggaa ctgaggccgc agcgcccgaa gagattgtga aggcaaccgg gccggaggcg       120
     gcggaaaaac cggaagcggg tgcttccgcc gctggaccgg atcctctgga actcgccaag       180
     gcggagagcg cggacctgcg cgacaaatat cttcgcctcg ccgccgaaat ggacaatctg       240
     cgccgccgca ccgagcgcga cgtgaaggat gccaagtcct attccgtcgc cggcttcgcg       300
     cgcgacatgc tggccgtttc cgacaacctg cgccgggcgc tcgaagccat tccggccgag       360
     gcgagggaat ccggcgacgc cggtctcacc gcgctgatcg aaggcgtcga aatgaccgaa       420
     cgctccatgc tggcggcact cgagcgccat ggcgtcaagc aactggaccc gaccggccag       480
     aggttcgatc cgaacttcca ccaggccatg ttcgaggttc cgaacccgga ggttccgaac       540
     aacaccgtcg tccaggtcgt ccaggccggc tacacgatcg gcgagcgcgt gctgcgcccg       600
     gccatggtcg gcgtcgccaa gggcggcccg aagatcgtgg ctgcggaaag cgagacgccg       660
     gcggcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page