(data stored in ACNUC7421 zone)

EMBL: CP001389.HSLO

CP001389.HSLO        Location/Qualifiers
FT   CDS_pept        173663..174658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="NGR_c01530"
FT                   /product="Hsp33 protein"
FT                   /note="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23955"
FT                   /db_xref="GOA:C3MFB8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB8"
FT                   /protein_id="ACP23955.1"
FT                   /translation="MTETAPGLGEFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHSYPLPVARLVAETVVLAVLLGTSLKFEGKLIVQTQGDGPVDLVVADFSTPDRVRAYA
FT                   RYDEEALAAAEKGGRTQPHELLGNGILAFTIDQGVHTQRYQGIVALDGATLEEIAAVYF
FT                   RQSEQIPTKVRLAVAELLDRDENGKPRHRWRAGGMVAQFLPEAPERMRQPDLPGGDGDD
FT                   GDSSLLFDEDDLWAEAKVMVETIDIDELTDPTVGTERLLYRLFHERGVRVYQPQAVYDR
FT                   CSCSRDKIREVLEGLSDEDIEHSIEDGQIKVTCEFCSTNYRFEASEVRSQ"
     atgacagaga cagcaccggg acttggcgag ttcgattttg ccggtgacga ccacgtcgtt        60
     ccctttcagg tcgaaggtct cgacgtgcgc gggcgcgccg tgcagctcgg tccgatgctc       120
     gacgcgatcc ttgagcggca cagttatccg ctgccggtgg cacggctcgt cgccgagacc       180
     gtcgttctcg ccgttctgct cggaacctcg ctgaagttcg agggcaagct gatcgtccag       240
     acgcagggtg atgggccggt cgacctcgtc gtcgccgatt tctccactcc ggaccgggtt       300
     cgcgcttatg cgcgctacga cgaagaggca ctcgccgccg ccgaaaaggg cgggcgcacg       360
     cagccgcacg aactgctcgg caacggcatc cttgccttca cgatcgacca gggcgtccat       420
     acccagcgct accagggcat cgtcgcgctc gacggcgcga cgctggagga gatcgcagcg       480
     gtctacttcc gtcagtccga acagataccg accaaggtcc gcctcgccgt cgccgaactg       540
     ctcgaccggg acgaaaacgg caagccgcgg catcgctggc gcgccggcgg catggtggcg       600
     cagttcctgc ccgaggctcc cgagcgcatg cgccagccgg atctgccggg cggcgatggc       660
     gatgacggcg attccagcct gctcttcgac gaggacgatc tctgggccga agccaaggtg       720
     atggtcgaga ccatcgatat cgacgaactg accgacccga cggtcggcac cgagcggctg       780
     ctgtatcggc tgttccacga gcggggcgtg cgggtctacc agccccaggc cgtctatgat       840
     cgctgcagct gctcgcgcga caagatacgc gaggtcctgg agggattgag cgacgaggac       900
     atcgagcaca gcatcgagga cggccagatc aaggtgactt gcgagttctg ctccaccaac       960
     tatcgcttcg aggcaagcga ggtgcgttct cagtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page