(data stored in ACNUC7421 zone)

EMBL: CP001389.HSPH

CP001389.HSPH        Location/Qualifiers
FT   CDS_pept        complement(53382..53813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspH"
FT                   /locus_tag="NGR_c00510"
FT                   /product="small heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23855"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF18"
FT                   /protein_id="ACP23855.1"
FT                   /translation="MSRITPFTSPLLVGFDSMEKTLERIAKANDGYPPYNIERIRGDSA
FT                   AGTPERLRITLAVAGFSDEDLEVTTEENQLVIRGRQVETGERDYLHRGIAARQFQRTFV
FT                   LADGMRVLGAELRNGLLSVDLVRPEPVRMVKKINISVPE"
     atgagcagga ttacgccttt taccagcccg ctcctggtgg gtttcgacag catggaaaaa        60
     accctcgagc ggatcgccaa agcgaacgac ggatacccac cctacaatat cgagcgcatt       120
     cgcggcgata gcgccgccgg cacgccggag cggttgcgga tcacgctcgc cgtcgccggg       180
     ttttccgatg aggatctgga ggtgacgacg gaggagaacc agctcgtcat tcgcggccgt       240
     caggtcgaaa ccggcgaaag ggactatctg catcgcggca tcgccgcccg gcaattccaa       300
     cggaccttcg tcctcgccga tggcatgcgg gtgctcggcg ccgagcttcg aaacggcctg       360
     ctctcggtcg atctggtgcg ccccgagccg gtccgtatgg taaagaaaat taacatttcg       420
     gtcccagaat ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page