(data stored in ACNUC7421 zone)

EMBL: CP001389.ISPE

CP001389.ISPE        Location/Qualifiers
FT   CDS_pept        complement(507667..508635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="NGR_c04560"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="CMK;
FT                   4-(cytidine-5-diphospho)-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24252"
FT                   /db_xref="GOA:C3MHC4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC4"
FT                   /protein_id="ACP24252.1"
FT                   /translation="MPRRRCRRSPPRRTRNPDSMPADGIAGFALTLAAPAKINLALHVV
FT                   GQRADGHHLLESLVTFAECGDRIAFAPADADHFTVSGPFSRDLPVSADGKSGNLVLRAR
FT                   DLLRRELIGRGAPTTSVHLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAEIAPERLA
FT                   SLALELGADVPMCLDGRPLLARGIGEEIAPLADLPSFAIVLVNPLVAVSTPVIFRMLAE
FT                   KRNPPLALPHGAHTAAAWLAALADMRNDLERPARALEPAVETVSDALQAVRADLVRMSG
FT                   SGATCFGLFDSDEKAGAAAQRISADQPGWYVLATRTAGKRG"
     atgccaagga gacgctgccg aagaagcccg ccgcgccgga caagaaatcc tgatagcatg        60
     ccggccgacg gcatcgccgg cttcgcgctg acccttgcgg cgccggccaa gatcaacctg       120
     gcactgcatg tcgtcggtca gcgcgccgac ggacatcatc ttctggaaag cctcgtcacc       180
     ttcgcagagt gcggcgaccg gatcgcattc gcgccagcgg atgccgacca cttcaccgta       240
     tccggcccgt tttcgcgcga tctgccggtc tcggcggacg gcaagagcgg caatctggta       300
     ttgcgggctc gcgatctttt gcggcgggag ctgatcggac ggggcgctcc gaccacctct       360
     gtgcatctgc atctggagaa gaacctgccg atcgcctccg ggatcggcgg gggctcggcc       420
     gacgcggccg ccacgcttcg cggcctgctt tcgctctgga aagccgagat cgcgccggaa       480
     aggctcgcca gcctcgccct ggaacttggc gccgatgtgc cgatgtgtct cgacggcagg       540
     ccgctgcttg ccagggggat cggcgaagag atcgccccgc ttgccgatct gccgtccttt       600
     gcgatcgttc tcgtcaatcc gctcgtcgcc gtctcgacgc ccgtcatctt tcggatgctc       660
     gccgagaagc gcaatcctcc cctcgccctg ccgcacggcg cccataccgc cgcggcctgg       720
     ctggcagccc tcgccgacat gcgcaacgat ctggagcggc cggcgagagc gctggaaccg       780
     gcggtcgaga cggtatcgga cgcgttgcaa gcggtgcgtg ccgatctcgt acggatgtcc       840
     ggctcgggcg ccacgtgttt cggtctgttc gacagcgacg aaaaggcggg cgcggccgcg       900
     cagcgcattt ccgccgatca gccgggatgg tacgttctag ccacccgaac cgcggggaag       960
     cgaggataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page