(data stored in ACNUC7421 zone)

EMBL: CP001389.KDTA

CP001389.KDTA        Location/Qualifiers
FT   CDS_pept        475489..476802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="NGR_c04250"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24221"
FT                   /db_xref="GOA:C3MGV6"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV6"
FT                   /protein_id="ACP24221.1"
FT                   /translation="MSSLRARLALSSYRWLGTAIYPFVVPYLAVRAAKGKEDPARRRER
FT                   YGHASAPRPPGPLVWFHAASVGETVAVTPLIKEIRRRGIAVVLTTGTTTSARVAAERLG
FT                   TAVIHQYVPLDFKPAVSRFLEYWQPDLAIIAESEIWPMTIVELGRRHIPQVLVNGRLSD
FT                   RTFARWKKRPSLADALFENLALVIAQSDVDAERFRTLGALPVMVSGNLKVDTDAPPHDP
FT                   QALRDYSQQIGARKTWAAISTFEGEEEAAGVVHHALKQRNGLLTIVVPRHPERGDAVEA
FT                   ALAAKGLKVARRTRGDRLTPDVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAVLSGGNVQNFRETYQMLAKNGSAKIVRDVEMLAKGVNYLLGNDDMRRSMIDA
FT                   GLETVQQMRGALTATMKGLEPYVNPLVVKARLEPRAES"
     atgagcagcc tgcgcgcacg gcttgcgctg tccagctatc gctggctcgg cacggcgatc        60
     taccccttcg tcgtgcccta cctggcggtg cgggcggcga agggcaagga ggatccggcc       120
     cggcggcgcg aacgctacgg ccatgcgagt gcgccgcgcc cgccggggcc gctcgtctgg       180
     tttcatgcgg ccagtgttgg ggaaacggtt gcggtcaccc cgctgatcaa ggaaatccgc       240
     cgccgcggca tcgccgtggt cctgaccacc gggaccacga cctcggcgcg cgtcgccgcc       300
     gagcgtctgg gcaccgccgt catccatcaa tatgtgccgc tcgatttcaa gccggcggtg       360
     agccgcttcc tcgaatactg gcagccggat ctggcgatca tcgccgaatc ggaaatctgg       420
     ccgatgacga tcgtcgaact cggacggcgc cacattccgc aggttctggt caacgggcgc       480
     ctttcggacc ggaccttcgc ccgctggaag aaacggccgt cgctcgccga tgcgctgttc       540
     gagaacctcg cgctcgtcat cgcccagtcc gatgtcgatg cggagcgctt ccgcacgctc       600
     ggcgcgctgc cggtgatggt ttcgggcaat ctcaaggtcg acaccgacgc gccgccgcac       660
     gatccgcagg cgctgcgcga ttattctcag cagatcggtg cgcgaaagac ctgggcggcg       720
     atctccacct tcgagggcga ggaagaggcg gccggggtcg ttcaccacgc cttgaagcag       780
     cgcaatggcc tgctgacgat cgtcgttccg cgtcatcccg agcgcggcga tgccgtcgag       840
     gccgcattgg ccgccaaggg gctcaaggtt gcgcgccgga cgcgcggcga ccgcctgacg       900
     ccggacgtcg atatcttcct cggcgacacg atcggcgaaa tgggccttta tctgcggctg       960
     accgagattg ccttcgtcgg ccgttcgctc tttgccgaag gcggacagaa cccgctggag      1020
     cccgccatgc tcggctgcgc cgtgctttcg ggcggcaatg tccagaattt ccgcgagacc      1080
     tatcagatgc tcgccaagaa cggcagcgcc aagatcgtcc gcgatgtcga aatgctggcg      1140
     aagggcgtca actacctgct cggcaacgac gacatgcgtc gctcgatgat cgacgccggg      1200
     ctcgaaaccg tgcaacagat gcgaggcgca ctgacggcga cgatgaaggg gctcgaaccc      1260
     tacgtcaatc cgctggtggt aaaggcgcgg ctggagccgc gcgccgaaag ctga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page