(data stored in ACNUC7421 zone)

EMBL: CP001389.KEFB

CP001389.KEFB        Location/Qualifiers
FT   CDS_pept        complement(470922..472778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="NGR_c04210"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24217"
FT                   /db_xref="GOA:C3MGV2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV2"
FT                   /protein_id="ACP24217.1"
FT                   /translation="MQTTPILYTQALMLLGGAVVAAPLFKRLGLGTILGYLAAGIVIGP
FT                   VAQSITEGEEILHVSELGVVFLLFIIGLELKPSRLWQMRRDIFGLGTAQVLVTGLVLSF
FT                   LIEFFSLLEWRGSVIAGFGLALSSTAFAMQILDENNDTNTRYGQRAFSILLLQDLAIVP
FT                   LLALIPLMATRAPEATTTAFEDFAIAIAAIAALYAAGRYLLNPLFQVIARTGARDVMIA
FT                   AALLVVMGAATMMQLAGLSMAMGAFLAGVLLAESSYRHELEADIEPFRGILQALFFMAV
FT                   GLSLELHVIAENYLLILVAVPVLMAVKSLVLYGICRATGSHHNDAVRISLLLPQGGEFG
FT                   FVLFTAAAIAGVFTQGVGSLLVAIVTLSMALTPVAALLSKRLLREHEELEDEIEEDFEG
FT                   AGADVLMIGFSRFAQIAAQILLAGGRDVTIIDHSAARVRQAATFGFRIYFGDGTRLDVL
FT                   RAAGIEKAKIVAVCTQKKEITDRIISLVQAEYPNARIFARSYDRLHTLELRAMGVEYEL
FT                   RETFESGLLFGRKTIEALGVGGEEALAIMDDIRRRDEARLVLQEAEGITAGRHMLHSEP
FT                   VRPEPLVKPKRDVNHTVETEERILTQLPAANDGRADTLASAD"
     atgcagacga ccccgatcct ctatacccag gcgctgatgc tgctcggcgg cgccgtcgtt        60
     gcagcgccgc tcttcaagcg cctcgggctc ggtacgattc tcgggtatct cgccgccggc       120
     atcgtgatcg gtccggttgc ccagtcgatt accgagggcg aagagatcct tcacgtatcg       180
     gagctcggcg tcgtcttcct gctgttcatc atcggcctcg agctgaagcc atcgcgactg       240
     tggcagatgc gccgcgacat tttcggcctg ggcacggcgc aggtgttggt gacaggcctc       300
     gttctctcct tcctcatcga gttcttcagc ctgctcgaat ggaggggcag tgtgattgcc       360
     ggctttggcc tggcgctttc gtcgacagct ttcgccatgc agatcctcga cgaaaacaac       420
     gataccaaca cgcgctacgg ccagcgcgcc ttttccatcc tcctgctcca ggacctggcg       480
     atcgtcccgc tgctcgcttt gatcccgctg atggcgacgc gcgctccgga ggccacgacc       540
     acggccttcg aagacttcgc gattgcgatc gccgccatcg cggcgcttta cgcggcgggc       600
     cgctacctgc tcaacccact tttccaggtg atcgcccgca ccggtgcccg cgatgtcatg       660
     atcgccgcag cgctgctcgt cgtcatgggc gcggcgacga tgatgcagct ggctggcctc       720
     tcgatggcga tgggcgcctt tctggcgggc gtgttgctcg cggaatcctc ctatcgccac       780
     gagctcgaag ccgatatcga gccgtttcgc ggtatcctcc aggcactgtt cttcatggca       840
     gtcggattgt cgctcgaact ccacgtcatc gccgagaact atctgctgat cctcgtcgcc       900
     gtgccagtgc tcatggcggt gaagagcctc gttctctatg ggatctgccg cgccacgggt       960
     tctcaccaca atgatgccgt gcgcatcagc ctgcttctgc cgcagggtgg cgaattcggc      1020
     ttcgtgctct tcacggccgc agccattgca ggcgtcttca cgcaaggcgt cggctccctg      1080
     ctcgtcgcaa tcgtcacgct ttccatggca ttgacgccgg ttgcggcgct gctgtcgaaa      1140
     cggctgctgc gcgagcacga ggagttggaa gacgagatcg aggaggactt cgaaggcgcc      1200
     ggcgccgacg tgctgatgat cggcttttcg cgcttcgccc agatcgccgc gcagattctc      1260
     ttggccggcg gccgcgacgt gacgatcatt gatcattccg cggctcgcgt tcgccaggcc      1320
     gcgaccttcg ggttccgcat ctatttcggc gatggcacgc ggctcgacgt cttgcgggcg      1380
     gccggcatcg aaaaggcgaa gatcgtcgcg gtctgcacgc agaagaagga aatcaccgac      1440
     aggatcatca gcctcgtcca ggcggaatat ccgaacgccc gcatcttcgc ccgttcctat      1500
     gatcgcctgc atacgctgga actgcgtgcc atgggtgtcg agtacgagtt gcgcgagacc      1560
     ttcgagtccg gcctgctgtt cggccgcaag acgatcgaag cgctcggcgt cggcggcgag      1620
     gaagctctcg ccatcatgga cgacatccgc cgccgcgacg aggcgcggct ggtgctgcag      1680
     gaggccgaag gcatcacggc cgggcgccac atgctccatt cagagccggt gcggccggaa      1740
     ccgctggtca agccgaaacg ggacgtcaac cacacggtgg aaaccgaaga gcggatccta      1800
     actcagcttc ctgccgcaaa cgatggtcgc gccgacacgc tggccagtgc cgactga         1857
//

If you have problems or comments...

PBIL Back to PBIL home page