(data stored in ACNUC7421 zone)

EMBL: CP001389.KPSF

CP001389.KPSF        Location/Qualifiers
FT   CDS_pept        229334..230344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="NGR_c02040"
FT                   /product="sugar isomerase, KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24004"
FT                   /db_xref="GOA:C3MFV3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV3"
FT                   /protein_id="ACP24004.1"
FT                   /translation="MGLRHVKGEGHSPSAILDSIGRTLTTASNGIKALAEHLATDESFA
FT                   QSLVEAVELVGDGHGRVVVSGVGKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLGMV
FT                   TSDDVLILLSWSGETAELANMLTYAKRFKVPIVSISSNRDSILARNSEIALVLPKVPEA
FT                   CPHGLAPTTSAMLQLAVGDALAIALLERRGFSAEDFKTFHPGGKLGAQLRLVHELAHVA
FT                   DQMPLLVVGRPMSEAVIEMSAKGFGVVGIVDEGGVLVGVITDGDLRRHMAGDLLGQPVE
FT                   EVMSCHPKVIQADVLASAAMEFMQEHKVTVLFLVDETGMPEGILHIHDLLRAGVA"
     atgggcttgc gacatgtgaa gggtgagggg cattccccca gcgccattct ggactctatc        60
     ggccggacgc tgacgacggc gagcaacggc atcaaggcac tggccgagca cctggcgacg       120
     gacgaaagtt ttgcgcagag cctcgtcgag gcggtcgaac tggtcggcga cgggcatggc       180
     cgcgtcgtcg tttccggcgt cggcaagagc gggcatatcg gccggaagat cgccgcgacc       240
     ctggcctcca ccggcacctc cgcctatttc gtccacccga ccgaggccag ccacggcgac       300
     ctcggcatgg tcacttccga tgacgttctc atcctgttgt cctggtcggg agagacggcg       360
     gagctcgcca acatgctcac ctatgccaag cgcttcaagg tgccgatcgt atcgatctcg       420
     tcgaaccgcg acagcatcct ggcccgcaat tccgagatcg ccctcgtgct tccaaaggtg       480
     cccgaggcct gtccgcacgg gttggcgccg acgacttcgg ccatgctgca gctcgccgtc       540
     ggcgatgcgc tggcaatcgc gcttctggaa cggcgcggtt tttccgcgga ggatttcaag       600
     actttccacc cgggcggcaa gctcggcgcg cagttgcgcc tcgtgcacga gctggcgcat       660
     gtggcggatc agatgccgct actcgtcgtc ggccggccga tgagcgaagc cgtcatcgaa       720
     atgtcggcga aaggtttcgg cgtcgtcggc atcgtcgatg aaggcggcgt gctggtcggg       780
     gtgatcaccg acggcgattt gcgccggcac atggccggag acctgcttgg ccagccggtc       840
     gaagaggtga tgtcgtgtca cccgaaggtg atccaggcag acgtgctggc gagcgccgcc       900
     atggaattca tgcaggagca caaggttacc gtgctgttcc tcgtcgacga aacagggatg       960
     cctgagggca tcctccatat tcacgatctc ttgcgcgccg gcgttgcctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page