(data stored in ACNUC7421 zone)

EMBL: CP001389.LPXK

CP001389.LPXK        Location/Qualifiers
FT   CDS_pept        477656..478696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="NGR_c04270"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24223"
FT                   /db_xref="GOA:C3MGV8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGV8"
FT                   /protein_id="ACP24223.1"
FT                   /translation="MVSEAPPFWWTKADWRAYALWPFAWAYGRVAAIRMDRARRAMPPV
FT                   PLICVGNFTVGGAGKTPTAIALAQAAKARGLKPGFLSRGYGGSLDVTTVVDPGHHRARD
FT                   VGDEPLLLAREALTVVCRRRVDGARRLAAEGADIIIMDDGFQSARLTFDFALLVIDSMR
FT                   GIGNGHLVPSGPVRAPIADQLRHATALLKIGHGPAADRLIRRAARAGKAIYVADTVRLD
FT                   DGSMSGVKVLAWAGIADPEKFYRTVRDAGAIVEETRSFPDHHHFSDDEIADLIDRAASQ
FT                   GYTLVTTAKDMVRLEPGHGRAAELAAKSRVIEIEVRFDDPLAPAKIIDATLAAARARKL
FT                   RANGKG"
     atggtttccg aagcgcctcc gttctggtgg acaaaggccg attggcgggc ctatgcgctc        60
     tggcccttcg cctgggctta cggccgcgtc gcggcaatcc gcatggaccg ggcgcgccgc       120
     gccatgccgc ccgtgccgct catctgcgtc ggcaacttca cggtcggcgg ggccggcaag       180
     acgccgacgg ccatcgcgct ggcgcaggcc gccaaggcgc gggggctgaa gccgggtttc       240
     ctgagccgcg gttacggcgg ctccctggac gtcacgacgg tcgtcgatcc cggccatcac       300
     cgagcccggg acgtcggcga tgaaccgctg ctgctggcgc gcgaggccct gacggtcgtt       360
     tgccgccgtc gtgtcgacgg cgcccgcagg ctcgccgccg agggtgccga catcatcatc       420
     atggatgatg gcttccagag tgcccgcctt accttcgatt tcgcgctgct ggtgatcgat       480
     tcgatgcgcg gcatcggcaa cggccatctc gtgccgtccg gcccggttcg ggcgccgatc       540
     gccgatcagc ttcggcacgc cacggcgctt ctgaagatcg gccacggtcc ggccgccgat       600
     cgcctgatcc gccgggcggc gcgcgccggc aaggccatct acgtcgccga cacggtgcgg       660
     ctcgatgacg gatcaatgtc cggcgtcaag gtgctggcct gggccggcat tgccgatccg       720
     gagaagttct accggacggt ccgcgacgca ggggcgatcg tcgaagagac gcgcagcttc       780
     ccggaccatc accatttttc agacgacgag attgccgatc tcatcgatcg cgccgcaagc       840
     cagggctaca cgctggtgac gacggccaag gacatggtcc gcctcgagcc cggccacgga       900
     cgggccgcgg agctggccgc caaaagcagg gtcatcgaaa tcgaggtgcg tttcgacgat       960
     ccgctggcgc ccgccaagat catcgacgcg acgcttgccg cggcgcgagc gcgcaaattg      1020
     cgggcaaatg ggaagggctg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page