(data stored in ACNUC7421 zone)

EMBL: CP001389.MEXE

CP001389.MEXE        Location/Qualifiers
FT   CDS_pept        complement(68515..69720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexE"
FT                   /locus_tag="NGR_c00630"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23867"
FT                   /db_xref="GOA:C3MF30"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF30"
FT                   /protein_id="ACP23867.1"
FT                   /translation="MTSSVTRRALWGAGLSILLSVAGGGAVLLGLPAHLKADAATEASP
FT                   AAPPAVPVSVAKAETRRITTWESFSGRLEAIERVEVRPRVGGAILSAHFREGALVEKGD
FT                   LLVTIDPEPYAAAVERAEAEVAAAEARVALAKTELDRARKLVSTSAIPQSGVDQRSSAY
FT                   DEAQANVRSAKAALRSARLDLGYTEVRAPIAGRAGRLEVTAGNLVAAGSASPVLTTLVS
FT                   VDPIYASFNVNEEVVAAALAKLSASAGADSIERIPVEIGTAADEGTPISGHIQLINNEV
FT                   DAATGTIRVRAALENPDGRLIPGQFVRIRIGDPAPAEKLVISDRAIGSDQDKKFVLVVG
FT                   SDNKVEYRQVTLGPTSDGMRIVESGLKPGESIVVNGLQRVRPGVVVAPQPAEQATASIA
FT                   KP"
     atgacgtcga gcgttactcg ccgcgccctg tggggcgccg gcctcagcat tctattgtcc        60
     gtcgccggcg gaggggccgt ccttctcggc ctccccgctc acctaaaggc tgacgcggcg       120
     accgaagcgt cgccggccgc cccgcccgcc gttccggttt ccgtcgccaa ggcggagacg       180
     cgccggatca ccacctggga gagcttctcg ggccggctcg aggcgatcga gcgggtcgag       240
     gttcgccccc gcgtcggcgg cgcgatcctc agcgcccatt tccgcgaggg ggcgctcgtc       300
     gaaaagggcg acctgctcgt caccatcgac cccgagccct atgcggccgc cgtcgagcgg       360
     gccgaggccg aggtcgccgc ggccgaggcg cgggtggcgc tcgccaagac cgagctcgac       420
     cgcgcccgca agctggtcag caccagcgcc atcccgcaga gcggcgtcga ccagcggtcg       480
     agtgcctatg acgaggcgca ggcgaatgtc cgttcggcca aggcggcgct gcgctccgcc       540
     cgcctcgacc tcggctatac cgaggtgcgc gctccgatcg ccggacgcgc cggcaggctt       600
     gaggtaactg ccggcaacct ggtcgcggcg ggctccgcct cgccggtgct gaccacgctg       660
     gtttcggtcg acccgatcta tgcgagcttc aacgtcaacg aggaagtcgt cgcagcggcg       720
     ctcgccaagc tctccgcttc ggccggcgcc gattcgatcg agcgcattcc ggttgagatc       780
     ggcacggccg cagacgaggg cacgccgatc agcggccata tccagttgat caacaacgag       840
     gtggatgcgg caaccggcac catccgtgtc cgggcggcgc tggaaaatcc tgatggccgg       900
     cttatcccgg ggcagttcgt acggatccgt atcggcgatc cggcgccggc ggagaaactg       960
     gtgatcagcg accgtgccat cggctccgac caggacaaga aattcgtgct ggtcgtcggc      1020
     tcggacaaca aggtcgaata ccggcaggtg accctcggcc cgacgtctga cggcatgcgg      1080
     atcgtcgaaa gcggcctgaa gcccggcgag agcatcgtcg tcaacggcct gcagcgggtg      1140
     cgccccggcg tcgtcgtcgc gccgcagccg gccgagcagg caactgcctc gatcgccaaa      1200
     ccatag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page