(data stored in ACNUC7421 zone)

EMBL: CP001389.MIAB

CP001389.MIAB        Location/Qualifiers
FT   CDS_pept        43154..44554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="NGR_c00410"
FT                   /product="putative tRNA-i(6)A37 modification enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23845"
FT                   /db_xref="GOA:C3MF08"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF08"
FT                   /protein_id="ACP23845.1"
FT                   /translation="MTQETALLPKSPRAGDEHVPARKVFVKTYGCQMNVYDSDRMSDAL
FT                   SRDGYVATDVLEDADFVLLNTCHIREKAAEKVYSELGRLRELKKAKASEGREMVIGVAG
FT                   CVAQAEGNEILRRAPAVDLVIGPQTYHRLPEALKRARSGERVVETDYAIEDKFEHLPAP
FT                   DKAKTRSRGVTAFLTVQEGCDKFCTFCVVPYTRGAEVSRPVAQILAEAEKLVDGGVREI
FT                   TLLGQNVNAWHGAGPNGRDWGLGDLLRRLGEIDGLARLRYTTSHPRDMDESLIEAHRSM
FT                   AKLMPYLHLPVQSGSDRILKAMNRRHTAAEYLALVERIRAVQPDLALSGDFIVGFPGET
FT                   EADFEETMRLVEVVGYAQAFSFKYSTRPGTPGADLKDQVPEDVKAKRLERLQSLLVNQQ
FT                   RDFAAACVGREIDLLLEKPGRMPGQLVGRSPWLQPVNVDAKRSQIGDIIKVRITKAGSN
FT                   SLFAEMIE"
     atgacccagg aaaccgctct tctgccgaaa tcgccccggg cgggcgacga acacgttccg        60
     gcccgcaagg tcttcgtcaa gacctatggc tgccagatga atgtctacga ttccgatcgc       120
     atgtccgacg ctctgtcgcg ggacggctac gttgcgacgg acgtgctgga agatgccgac       180
     ttcgtcctgc tcaacacctg tcatatccgc gaaaaggccg ccgaaaaggt ctattccgag       240
     ctcggccgcc tgcgcgagct gaagaaggcg aaggcgagcg agggccgcga aatggtgatc       300
     ggcgtcgccg gctgcgtcgc ccaggccgaa ggcaatgaaa tcctgcggcg cgctccggcc       360
     gtcgatctcg tcatcggccc gcaaacctac catcggctgc cggaagcctt gaagcgtgca       420
     aggagcggcg agcgggtcgt cgagacggat tacgccatcg aggacaagtt cgagcatctg       480
     ccggcaccgg acaaggcgaa gacccgttcg cgcggggtaa cagccttcct caccgtgcag       540
     gaggggtgcg acaagttctg caccttctgc gtggtgccct acacccgcgg cgccgaggtc       600
     tcgcggccgg tggcgcagat cctcgccgag gcggaaaagc tggtcgacgg cggcgtgcgc       660
     gagatcacgc tgctcggcca gaacgtcaat gcctggcacg gggcggggcc caacggccgc       720
     gattggggcc ttggagatct gttgcgccgt ctcggcgaga tcgacggcct cgcgcgcctg       780
     cgctacacca ccagccaccc gcgcgacatg gacgagagcc tgatcgaggc gcaccggtcg       840
     atggccaagc tgatgcccta tctgcatctg ccggtccagt ccggctccga tcgcatcctg       900
     aaggcgatga accggcgcca tacggcggcc gaatatctcg cccttgtcga aaggatccgt       960
     gccgtccagc ctgatctggc actttccggc gatttcatcg tcggcttccc cggcgagacc      1020
     gaggcggatt tcgaggagac gatgcgcctc gtcgaggtgg tcggttatgc acaggcattc      1080
     tccttcaaat attcgacccg tcccggtacg ccgggcgccg atctaaagga tcaggttccc      1140
     gaagacgtga aagccaagcg actggaaaga ttgcagagtt tgcttgtcaa ccagcagcga      1200
     gactttgccg ccgcctgcgt cgggagggaa atcgatctgc tgctggagaa gcccggccgc      1260
     atgcccggcc agctggtcgg ccgctcgcct tggctgcagc ccgtgaatgt tgatgcaaaa      1320
     cgatcgcaaa tcggtgacat tatcaaggta cgaatcacca aggccggctc gaacagcctg      1380
     tttgccgaga tgatcgaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page