(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTA

CP001389.MOTA        Location/Qualifiers
FT   CDS_pept        complement(310756..311634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="NGR_c02690"
FT                   /product="chemotaxis protein motility protein A"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24067"
FT                   /db_xref="GOA:C3MG16"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG16"
FT                   /protein_id="ACP24067.1"
FT                   /translation="MNIIIGLLVTFGCILGGYLAMGGHLEVLNQPFELMIIGGAGIGGF
FT                   IMANSMKVVKDTGKALGEAFKHKVPKERHYLDTLGVLYSLMRDLRTKSRNEIESHIDNP
FT                   EESPIFQSAPTVLQNKELTAFICDYVRLIIIGNARSHEIEALMDEEIHTITHDKMKCYH
FT                   ALTSMGDALPAIGIVAAVLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGP
FT                   LVANIKAVREKQNRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGGGESKAA"
     atgaatatca tcatcgggct ccttgtgact ttcggctgta tcctcggcgg atacctcgcc        60
     atgggcggcc acctggaagt cctcaaccag cccttcgagc tgatgatcat cggcggggcc       120
     ggcatcggcg gcttcatcat ggccaattcg atgaaggtgg tgaaagatac cggcaaagcg       180
     ctcggcgaag ccttcaagca caaggtaccg aaggagcgcc actacctcga cacgctcggc       240
     gtgctctaca gcctgatgcg cgacctgaga accaagtcgc gcaacgagat cgagagccac       300
     atcgacaatc ccgaggaatc gccgatcttc caatccgcgc cgaccgtcct gcagaacaag       360
     gagctgacgg cgttcatctg cgactatgtg cggctcatca tcatcggcaa tgcccgctcg       420
     cacgagatcg aagcgctgat ggacgaggaa atccatacga tcacccacga taagatgaag       480
     tgctatcacg ccttgacgag catgggggat gcgctgccgg cgatcggcat cgtcgcggcg       540
     gttctcgggg tcatcaaggc gatgggcgcc atcagcgagg cgccggaagt gctgggtgca       600
     aagatcgccg ccgccctcgt cggaacgctg ctcggcgtgt tcctgtccta ttcgatcgtc       660
     gggccgctcg tcgccaacat caaggcggtg cgcgaaaagc agaaccggct ctacgtcatc       720
     gtcaagcaga cattgctcgc atacatgaac ggctccgttc cccaggtcgc ccttgaatat       780
     ggccgcaaga cgatctccgc ctatgagcgg ccgtccatcg atgcggtcga gcaggagatg       840
     atgaatccgg gcggcggcgg cgaaagcaag gcggcgtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page