(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTB

CP001389.MOTB        Location/Qualifiers
FT   CDS_pept        327625..328803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="NGR_c02890"
FT                   /product="chemotaxis protein motility protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24087"
FT                   /db_xref="GOA:C3MG36"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG36"
FT                   /protein_id="ACP24087.1"
FT                   /translation="MSEESHHNGKNEIIIVKRSGDGHDGHHGGGWKIAYADFMTAMMAF
FT                   FLVMWLINAANEETKAAIASYFNPVQLTDQKPAEKGLKNPAKDAQGEETQQRSKSDGEQ
FT                   TKSGGSAKTGDQLTATSGEETKYSDADFFENPYSVLSEIAKEAGQQANISAKGEGGAAQ
FT                   SGPATGAEGGEAYRDPFDPDFWTKQVEVKDAGNATEGDVADADAGNNPAAGEALKTAEA
FT                   RKGEVPLEQEAEAQQQQKEAEALKAEIEKAVGGEAGRLLEGLVVTPSEGGLLVTISEQT
FT                   DAPMFAVGSAVPAKDLVLAMEKIGTLLAERQGAVAIRGHTDGRPFKDGTYDNWRLSAAR
FT                   AQSAYYMLVRGGLKEQRVNQISGFADRRLQVPNDPYAAANRRIEILLQSGQG"
     atgagcgaag aaagccatca caacggcaag aacgaaatca tcatcgtcaa gcgctccgga        60
     gacggccacg acggccatca cggcggcgga tggaagatcg cctatgccga cttcatgacc       120
     gcgatgatgg ccttcttcct cgtcatgtgg ctgatcaacg ccgccaacga ggagacgaag       180
     gcggcgattg cctcctattt caatccggtg cagctcaccg atcagaagcc ggcagagaag       240
     ggcctgaaga atccggccaa ggatgcccag ggcgaagaga cgcagcagcg ctcgaagtcg       300
     gatggcgagc agacgaaatc cggcggttcc gccaagaccg gcgaccagtt gacggccact       360
     tccggcgagg agacgaagta ttccgacgcc gacttcttcg agaaccccta ttcggtgctc       420
     tccgagatcg ccaaggaggc cggacagcag gccaatatca gcgccaaggg ggagggcggt       480
     gccgcccagt cgggaccggc gaccggcgcc gaaggcggcg aggcctatcg cgatccgttc       540
     gatccggatt tctggaccaa gcaggttgaa gtcaaggatg ccggcaatgc cactgaaggc       600
     gacgtcgcgg atgccgatgc cgggaataat ccggctgccg gcgaagcgct gaagaccgcg       660
     gaagcccgca aaggcgaggt gccgctcgag caggaagcgg aagcacagca gcagcagaag       720
     gaggccgaag ccctcaaggc cgaaatcgag aaggcggtcg gcggtgaggc cggacggttg       780
     ctcgaagggc tggtggtaac gccatccgaa ggcgggctgc tggtgacgat cagcgagcag       840
     acggatgcgc cgatgtttgc ggtgggctct gcggttcccg cgaaggacct cgtcctcgcc       900
     atggaaaaga tcggcacgct gctcgccgag cgtcaggggg ccgtggcgat ccgcggccac       960
     acggatggcc gcccattcaa ggacggaacc tacgacaact ggcggctgtc ggcggcacgc      1020
     gcccagagcg cctattacat gctggtccgc ggcggtctca aggaacagcg cgtcaatcag      1080
     atcagcggct ttgcggaccg gcgcctgcag gtgccgaacg atccctatgc tgccgccaac      1140
     cggcggatcg agatcctgtt gcagtcgggg cagggttga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page