(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTC

CP001389.MOTC        Location/Qualifiers
FT   CDS_pept        328809..330116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motC"
FT                   /locus_tag="NGR_c02900"
FT                   /product="chemotaxis protein motility protein C"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24088"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG37"
FT                   /protein_id="ACP24088.1"
FT                   /translation="MLKRLGAILATSVLAVPLAIGLARASETEELAPFKMVRSLQYVQD
FT                   SVVLGDHSAIEMQRFMLNKIDKRLRAADEAIFRDPRNVDAALVYVMSGGNPETLDYLTD
FT                   RDVEGNFDARVAEALRQYLRGKGPLIVENLAKAAPEYKNSRVGPYLFLILGNATSQQDP
FT                   VAAMKYYDWARLTAPGTIIEEAALRRSVSLAVQAGDPEKGFRYALNYARRYLTSPYASQ
FT                   FADVFVELAVTHFDETVEKRVAEILAFMDQSRQREVYLRVARRAAIGGNQTLARLASSR
FT                   AEELALDGGGQSQLLASFYDGLAAVPSEDVFTAAQTLAAIPDGKLSRRDRALREAARAI
FT                   AEEVVRLPRDESSAQASMPIPEANTGPAKDGGETGETGSGMSPFAVASDRPPAPGGERP
FT                   ASAETAAASDPALDGFVANGRSKIKEIDALLAEEGL"
     atgctgaagc ggctcggcgc catcctggcg acatcggttc ttgcggtccc gctggcgatc        60
     ggccttgcgc gcgcaagcga gacggaagag ctcgcaccgt tcaagatggt caggtctctg       120
     caatatgtcc aggattccgt cgtgctcggc gaccattcgg cgatcgagat gcagcgcttc       180
     atgctgaaca aaatcgacaa gcgtctgcgg gcggcagacg aagcgatctt tcgcgatccg       240
     cgcaacgtcg atgcggcgct tgtctatgtc atgagcggcg gcaatccgga aacgctggat       300
     tatctgaccg acagggatgt cgagggcaac ttcgatgccc gggtcgcgga ggcgctccgg       360
     cagtatctgc gcggcaaggg gccgttgatc gtcgaaaatc tcgccaaggc ggcgcccgaa       420
     tacaagaatt cgcgcgtcgg cccttaccta tttctcatcc tcggtaacgc cacgtcgcag       480
     caggatcctg ttgccgcgat gaaatactac gactgggcgc gactgacggc gcccggcacc       540
     atcatagagg aggcggcgct tcgccgctcc gtgtctctcg cggtgcaggc aggcgacccc       600
     gaaaaaggct tccgctatgc gctgaactat gcgcggcgct acctgacgtc gccctatgcg       660
     agccagttcg ccgacgtctt cgtcgaactg gcggtcacgc atttcgacga gacggtcgag       720
     aagagagtcg ccgagattct tgccttcatg gaccagtcgc gccagcgcga ggtctatctg       780
     cgcgtcgcaa ggcgggcagc gatcggcggc aaccagacac tggcgcgcct ggcgtccagc       840
     cgggccgaag agctcgctct ggacggcggc gggcaatcgc aactgctggc gagcttctac       900
     gatggccttg cggccgtgcc atccgaggac gtcttcacgg cggcgcagac gctggcggcg       960
     attccggacg ggaagctttc gcgacgcgac cgcgccctga gggaggccgc ccgcgcgatt      1020
     gcggaagagg ttgtacgact accgagggat gaaagctccg cgcaagcgtc catgcctata      1080
     ccggaggcca acactggtcc cgccaaggat ggcggcgaaa caggggagac gggaagcggc      1140
     atgagcccct ttgccgtggc gtccgatcgg ccgcccgcgc cgggtggcga acggccggca      1200
     agcgcggaaa ccgctgcggc gtccgacccg gctcttgacg gtttcgtggc caatgggcgc      1260
     tcgaagatca aggagataga tgcgctcctt gcggaggaag gactatga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page