(data stored in ACNUC7421 zone)

EMBL: CP001389.MOTD

CP001389.MOTD        Location/Qualifiers
FT   CDS_pept        330113..331594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motD"
FT                   /locus_tag="NGR_c02910"
FT                   /product="chemotaxis protein motility protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24089"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG38"
FT                   /protein_id="ACP24089.1"
FT                   /translation="MRPLEETFRAPAAAVGARPGSRQGGNEQVAGEPGAFESAVADAGR
FT                   QKTAAQGAAQGSGESAVDSAAEGTQTAAAEFTIGKPKAGVLIASATITGTGRLSTPSAK
FT                   GRGEGDADGALAEGQASSELKSVREKGNRQFSAAQADLEAEEASDPDGKAVTGKPKGHM
FT                   AAQTGAMEYSEAGATPEGDTGSAAPANGPVSDLLSLLGSAPPAAALDTAGGENTSNAAR
FT                   STGGRVAALAAETADVPADADAAEGSRTGEQGDAGSDRLFRFARADGKGQAVSMSISAD
FT                   GEATAVENGRPTANAKAEAVTVLEARRYLGVAMNTNSAAVTGAIAGDGAWAQALQSSAL
FT                   STQPEASSLAGKTLNTLKIQMHPIELGTVTATLRLKDDELQVDLKVETGEAFRQLRDDQ
FT                   SEMVKALRAQGFAVDQVNVVFNAGGDASNGSGSQPQTQGQLGQSAGERTGGDSGQGRQR
FT                   PNGGEAAQAETWWGNDGTDDAAAGVGHSRTGDVYM"
     atgaggccac ttgaagagac gttccgtgcg cccgccgccg cggtcggcgc ccggcccggt        60
     tcccggcagg gcggaaacga gcaggttgct ggagagcccg gcgccttcga gagcgcggtc       120
     gccgatgccg gtcgccagaa gacggcggcc caaggcgcgg ctcagggcag cggcgagagt       180
     gccgttgatt ctgccgcgga gggcacgcaa acggcggcag ccgaatttac aatcggcaag       240
     cccaaggcgg gtgtcctgat cgcgagcgcc accatcaccg ggaccggtcg cctgtcgacc       300
     ccttcggcca agggtcgcgg agagggtgat gcggacggcg cgcttgcgga ggggcaggca       360
     tcctccgagc tcaaatctgt tcgggagaag ggaaaccggc agttttcagc ggcccaggca       420
     gatctcgagg ccgaggaggc cagcgatccg gacggcaagg ccgttacggg taagccgaag       480
     ggacacatgg ccgcgcagac cggcgcaatg gaatactctg aggcgggggc gacgcccgag       540
     ggtgatacgg gttcggctgc gccggcaaac ggcccggtca gcgacctcct gtcgttgctc       600
     ggcagcgcgc cgccagccgc ggccctcgac accgcgggcg gcgagaacac cagtaacgca       660
     gcacggtcga cgggcggccg cgtcgccgcc ctggccgccg aaacggccga tgtcccggcg       720
     gacgccgacg cggcggaggg ttcgcggacg ggagagcagg gcgatgccgg atcagaccgg       780
     ctcttccgct tcgcccgcgc cgacggcaag ggacaagcgg tctcgatgag catttcggcg       840
     gacggcgaag caacggccgt cgagaacggc aggcctacgg ccaatgccaa ggccgaagcc       900
     gtgaccgtcc tcgaagcgcg ccgttacctg ggtgtcgcga tgaataccaa ctccgccgcg       960
     gtgacgggtg cgatcgccgg tgacggcgcg tgggcgcagg cgctccagtc gagcgcgctg      1020
     tcgacccagc cggaggcatc aagcctggcc ggcaagacgc tcaatacact gaaaatacag      1080
     atgcacccga tcgaactcgg tacggtcacg gcgacgctgc gcctgaagga cgacgagctg      1140
     caggtcgacc tgaaggtgga aacgggcgag gcgttccggc aactgcgcga cgaccagagc      1200
     gagatggtga aggcgttgcg cgcccagggc ttcgcggtcg accaggtgaa cgtcgtgttc      1260
     aatgccggcg gcgatgcctc gaacggcagc ggttcgcagc cgcagacgca gggccagctt      1320
     ggccaatcgg ccggcgagcg caccggtgga gacagcgggc aggggcgtca acggccgaac      1380
     ggcggcgagg cggcgcaggc cgagacatgg tggggcaatg atggaacgga cgatgcggct      1440
     gctggcgttg ggcactctcg cactggtgac gtctacatgt ag                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page