(data stored in ACNUC7421 zone)

EMBL: CP001389.MUTL

CP001389.MUTL        Location/Qualifiers
FT   CDS_pept        complement(479082..480884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="NGR_c04290"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24225"
FT                   /db_xref="GOA:C3MGW0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGW0"
FT                   /protein_id="ACP24225.1"
FT                   /translation="MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEVA
FT                   TAGGGKTLLRVTDNGNGMSPADLELAIRRHCTSKIDDTLTDIRTLGFRGEALPSIGSVA
FT                   RLSITTRTAGAREGAAISVIGGKTESVRPSPANVGTVVEVRDLFFATPARLKFMKTEKA
FT                   EAAAISEVVRRMAIAFPKVRFVVSGSDRSTLEFPATGDDRLARMAQVLGKDFRDNAIGI
FT                   DAEREEARLSGFAGVPTFNRGNSLQQYAFVNGRPVQDKLILSAIRAAYAETIPQGRYPV
FT                   AVLSIALDPALVDVNVHPAKSDVRFRDPGLIRGLIIGAIREALSRGGDRAATTGAQGMM
FT                   RSFRPEAYRAEPHRAQAPWTAATSPYRPMRFDEPARGFAEAPQAAFQEFAQPAARPAET
FT                   APNGTVEPAFPLGAARAQLHENYIVAQTEEGLVIVDQHAAHERLVFEAMRTALHSRPVP
FT                   AQALLIPEIVDLAEDDCDRLMAHAEEFLRLGLSIERFGPGAIAVRETPAMLGEMDASGL
FT                   VRQLADELAEWDTANGLAGRLDYLAATMACHGSVRSGRRMRPEEMNALLRQMEATPGSG
FT                   QCNHGRPTYIELKLADIERLFGRS"
     atggccatca agcaactctc ggaaacgctc atcaaccaga tcgccgccgg tgaagtcatc        60
     gagcggcccg ccagcgccgc caaggagctg atcgaaaatg ccctcgacgc cggcgcaacc       120
     aggatcgagg tggcgacggc cggcggcggc aagacgctgc tccgggtgac cgacaacggc       180
     aacggcatgt cgcccgccga tctcgaactg gcgatccgcc ggcattgcac gtccaagatt       240
     gacgacacgc ttacggacat ccgcaccctc ggcttccgcg gcgaagccct cccctcgata       300
     gggtcggtgg cgcgtctgtc gatcaccacg cgaacggcgg gtgccaggga gggggcggcg       360
     atctcggtga tcggcggcaa gacggagtcg gtccgcccct cgcccgccaa tgtcgggacc       420
     gtcgtcgagg tgcgcgacct tttcttcgct acaccggcgc ggctcaagtt catgaaaacg       480
     gaaaaggccg aagccgcggc gatttccgaa gtcgtccgcc gcatggcgat cgcctttccg       540
     aaggtgcggt tcgtggtatc cggttcggat cgctcgacgc tcgaatttcc ggcgacgggc       600
     gacgatcggt tggcgcgcat ggcgcaggtg ctgggcaagg actttcgtga caatgccatc       660
     gggatcgatg cggaacgcga agaggcgcgg ctcagcggat ttgccggcgt gccgaccttc       720
     aaccgcggca actcgctgca gcaatatgcc ttcgtcaacg gccggccggt gcaggacaag       780
     ctgatcctct ccgccatccg cgccgcttac gccgaaacca ttccgcaagg gcgctatccg       840
     gtcgccgtgc tctccattgc gctcgacccc gcgctcgtcg acgtcaacgt ccatccggcc       900
     aaatcggatg tccgtttccg cgatcccggg ctgatccgcg ggctgatcat cggggcgatc       960
     cgcgaggctt tgtcgcgcgg cggcgaccgg gcggcgacga ccggcgccca gggaatgatg      1020
     cgctccttcc gtccggaagc gtatcgagcc gagccgcaca gagcgcaggc gccctggacg      1080
     gcggccacct cgccctatcg gccgatgcgg ttcgacgagc ccgcccgcgg ctttgccgag      1140
     gccccgcaag cggcattcca ggaatttgcg cagccggcgg cgcgccccgc cgagacggcg      1200
     ccgaatggca cggtcgagcc cgcattcccg ctcggtgccg cacgcgcgca gctccacgag      1260
     aattatatcg tcgcccagac tgaagaaggc ctcgtcatcg tcgaccagca tgccgcgcat      1320
     gaacgtctcg tcttcgaggc gatgcggacg gcgctgcatt cgcggccggt gcctgcacag      1380
     gcgctgctca ttcccgaaat cgtcgatctc gccgaggacg actgcgaccg gctgatggcg      1440
     catgcggagg aattcctgcg gctcggactt tcgatcgagc gtttcgggcc gggggcgatc      1500
     gccgtgcgcg aaacgccggc gatgctcggc gagatggacg cttcagggct tgtgagacag      1560
     ctcgccgacg aacttgccga atgggacacc gccaatggcc ttgccgggcg gctcgactat      1620
     ctcgccgcga ccatggcgtg ccatggctcc gtccgctccg gtcggcggat gcggcccgaa      1680
     gagatgaacg cgctgctccg ccagatggag gcgacaccgg gatcggggca gtgcaaccac      1740
     ggccggccga cctatatcga gctcaagctt gccgatatag aacggctctt cggccggagt      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page