(data stored in ACNUC7421 zone)

EMBL: CP001389.MUTS

CP001389.MUTS        Location/Qualifiers
FT   CDS_pept        30127..32928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="NGR_c00310"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23835"
FT                   /db_xref="GOA:C3MEZ8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ8"
FT                   /protein_id="ACP23835.1"
FT                   /translation="MSSINACGYCDISFFGTIMNFVSDASSRTGDVLSVSDLASEESRS
FT                   TATPMMEQFIEIKANNPDSLLFYRMGDFYELFFQDAVEASRALGITLTKRGQHLGQDIP
FT                   MCGVPVHAADDYLQKLIALGFRVAVCEQVEDPAEAKKRGSKSVVRRDVVRLVTPGTITE
FT                   DKLLSPSESNYLMALARIRSGSEPAYALAWIDISTGIFRLAETAESRLLADILRVEPRE
FT                   LILPDTVFHDPELRPVFDVLGRVAVPQPAVLFDSATAEGRIARYYGVKTLDGFGTFSRA
FT                   ELAAASAAISYVEKTQIQERPALGIPERESAASTLFIDPATRANLELVKTLSGAREGTL
FT                   LRALDRTVTSGGARLLAERLMSPLTDPDRINQRLDSIEVLLDQPSFAIDVRDTLRRAPD
FT                   MPRALSRLALGRGGPRDLGAIQAGLRAAAATATLLSGARLSEELTEAHAAIAALPAALL
FT                   ARLDSMLAEDLPLLKRDGGFLREAASGELDEMRALRDQSRRVIAGLQLQYCEETGIKSL
FT                   KIKHNNVLGYFIEVTAGNAGAMTDTDAGRARFIHRQTMASAMRFTTTELAELETKIANA
FT                   ADRALAIELEAFEAMAREVVADAEAIKAASLALAMLDVSAGLAVLAEEQNYARPAVDRS
FT                   RMFLIDGGRHPVVEQALRRQAGNPFVANGCDLSPPDGPEAGAIWLLTGPNMGGKSTFLR
FT                   QNALIAIMAQMGSFVPANAAHIGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQA
FT                   TDHSLVILDEIGRGTATFDGLSIAWAAVEHLHEVNRCRGLFATHFHELTVLSEKLGRLS
FT                   NATMRVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVARARDVLANLEDADRK
FT                   NPASQLIDDLPLFQVAVRREEVARASGPSRAEEALRAINPDDMTPREALEALYALKKDL
FT                   AGR"
     ttgtcgtcta taaatgcttg cggatattgt gacatctctt tttttggaac aatcatgaat        60
     ttcgtgtctg acgcatcgag ccgcacgggc gacgtccttt ccgtgtccga tctggccagc       120
     gaggagagcc gctccactgc cacgccgatg atggagcagt tcatcgagat caaggcgaac       180
     aatccggatt cgcttctgtt ctaccggatg ggcgatttct acgagctgtt cttccaggat       240
     gcggtggagg cctcccgcgc gctcggcatc acgctgacga aacgcggcca gcatctgggc       300
     caggatatcc cgatgtgcgg cgtgccggtg catgccgccg acgactatct gcagaagctg       360
     atcgcgcttg gcttccgggt cgcggtctgc gagcaggtgg aagatcccgc cgaagccaag       420
     aagcgcggca gcaaatccgt cgtgcgccgc gatgtggtgc ggctggtgac gccggggacc       480
     atcaccgagg acaagctgct gtcgccctcg gaatcgaact atctgatggc gctggcccgc       540
     atccgcagcg gctcggagcc cgcctatgcg ctcgcctgga tcgatatttc gaccggtatc       600
     ttccgcctcg ccgagacggc cgagagccgt ctgctcgccg acatcctgcg cgtcgagccg       660
     cgcgagctga tcctcccgga caccgtcttc cacgatccgg agctgcgccc ggtcttcgac       720
     gtgctcggcc gggtggccgt gccgcagccc gcagtcctgt tcgacagcgc caccgcggaa       780
     ggccgcatcg cccgctatta cggggtcaag accctcgacg gtttcggcac cttctcccgc       840
     gccgaactcg cggccgcttc cgcggcgatc tcctatgtcg agaagaccca gatccaggag       900
     cgtccggcgc tcggtatccc cgagagggaa agcgccgcct cgaccctctt catcgacccg       960
     gcaacccgcg ccaatctcga actcgtcaag acgctctccg gcgcccgtga aggaaccttg      1020
     ctgagagccc tcgaccggac cgtcaccagc ggcggcgcgc gtctgctcgc cgagcggctg      1080
     atgtcgcctc tgaccgaccc ggatcggatc aatcagcggc tcgattcgat cgaggtgctg      1140
     ctcgaccagc caagcttcgc gatcgatgtc cgcgacacct tgcgccgcgc cccggacatg      1200
     ccgcgtgccc tgtccaggct cgcgctcggc cgcggcgggc cgcgcgacct cggcgccatc      1260
     caggcgggtc tccgcgctgc ggcggcgacc gcgacgctgc tttcgggcgc ccggctttcg      1320
     gaggagctga ccgaggcgca tgccgcgatc gccgcgctgc cggcagcctt gctggcgcgt      1380
     ctcgattcga tgctcgccga ggacctgccg cttctgaagc gcgatggcgg cttcctgcgc      1440
     gaagcggcga gcggcgagct cgacgagatg cgggcgctgc gcgaccagtc gcgccgggtc      1500
     atcgccggcc tgcaactgca atattgcgaa gagaccggca tcaagtcgct gaagatcaag      1560
     cacaacaatg tgctcggcta tttcatcgaa gtcaccgccg gcaatgccgg ggcgatgacc      1620
     gatacggacg ccggtcgcgc ccgtttcatc catcgccaaa ccatggcgag cgccatgcgc      1680
     ttcaccacga cggaacttgc cgagctcgaa acgaagatcg ccaatgccgc cgaccgggcg      1740
     ctggcaatcg agctcgaggc tttcgaggca atggcgcgcg aggtcgtcgc cgatgccgag      1800
     gcgatcaagg cggcgtcgct ggcgctcgcg atgctcgacg tctcggcggg gcttgccgtg      1860
     cttgccgaag agcagaacta tgcgcggccc gccgtcgatc gctcgcggat gttcttgatc      1920
     gatggcgggc gccatccggt cgtcgaacaa gcgctgcggc gccaggcggg caatcctttc      1980
     gttgccaatg gttgcgacct gtcgccgccg gacggtccgg aggccggtgc catctggctg      2040
     ctcaccggcc cgaacatggg cggcaagtcg accttcctgc ggcagaacgc gctgatcgcc      2100
     atcatggcgc agatgggttc cttcgtgcct gcgaacgccg cccatatcgg catcgtcgac      2160
     cggctctttt cgcgcgtcgg tgcctcggac gatctcgccc gcggccgctc gaccttcatg      2220
     gtcgagatgg tcgagacggc ggcgatcctc aaccaggcaa ccgaccactc gctcgtcatc      2280
     ctcgacgaga tcggccgcgg cacggcgacc ttcgacggcc tgtcgatcgc ctgggcggcg      2340
     gtcgagcacc tgcatgaagt caatcgctgc cgcggtctct tcgcgacgca tttccacgaa      2400
     ttgacggttc tctccgaaaa gctcgggcgc ctgtcgaacg ccaccatgcg ggtcaaggag      2460
     tgggacggcg acgtgatctt cctgcacgag gtcggccccg gtgcggccga ccgttcctac      2520
     ggcatccagg tcgcccgcct tgcgggtctc cctgcctcgg tcgtcgcccg ggcaagggac      2580
     gtcctagcca acctcgagga tgccgatcgc aagaacccgg cgagccagtt gatcgacgac      2640
     ttgccgcttt tccaggtggc cgtccggcgc gaggaagtgg caagggcatc cggcccttcc      2700
     agggccgaag aggcgctgag ggcgatcaat cccgacgaca tgacgccgcg cgaggcgctc      2760
     gaggcgctct atgctttgaa aaaggacctt gccggccgct ga                         2802
//

If you have problems or comments...

PBIL Back to PBIL home page