(data stored in ACNUC7421 zone)

EMBL: CP001389.MVIN

CP001389.MVIN        Location/Qualifiers
FT   CDS_pept        36098..37705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="NGR_c00330"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23837"
FT                   /db_xref="GOA:C3MF00"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF00"
FT                   /protein_id="ACP23837.1"
FT                   /translation="MSLVKKFATVGGATLGSRVFGFVRETFMAAALGTGPVADAFNTAF
FT                   RLPNTFRRLFAEGAFNAAFVPLFAKEIEARGMEGARRFSEEVFGVLFTVLLFLTIAMEL
FT                   AMPFIVRELIAPGFADDPAKFASTVTFATIMFPYLACMSLAAMMAGMLNSLHRYFAAAI
FT                   APVFLNVILIGVLAYAWYSGQDPVAVGYGLSWGVMAAGLVQLAIVWIAVRNAGIKIGFR
FT                   RPRLTANVRRLLVLALPAAITGGITQINLLINTNIASAQEGAVSSLVYADRIYQLPLGV
FT                   VGIAVATVLLPELSRALRGGNLNEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLF
FT                   ERGKFSPEATVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVS
FT                   LAVTLFPPLGASGIATAEIVAGWVNALLLFTTLLWRGHWGRDIPLLTRVPRLVIAAAIM
FT                   AAALHYAIEWLAFPLSSAAPLAVRAATVCGLVAAAMAIYFASAFGLGGASLGMIRRSLK
FT                   RRAAPAAAPTTGEGPDSP"
     atgagcctgg tcaagaaatt tgcgacggtc gggggcgcga cgctcggaag ccgcgtcttc        60
     ggctttgtgc gcgagacctt catggcggcc gcgctcggca ccggaccggt cgccgacgcc       120
     tttaacacgg cctttcggct gcccaatacc ttccgccggc ttttcgccga gggggcgttc       180
     aacgctgcct tcgtgccgct ctttgccaag gagatcgagg cacgcggcat ggagggcgcc       240
     cgccgctttt ccgaagaagt cttcggcgtc ctgttcacgg ttcttttgtt tctgacgatc       300
     gcgatggaac tggcgatgcc gttcatcgtg cgcgaactga tcgcccccgg tttcgccgac       360
     gatccggcga aattcgcaag caccgtcacc ttcgcgacga tcatgttccc ctatctcgcc       420
     tgcatgtcgc tggcggcgat gatggcgggc atgctcaatt cgctgcatcg ctatttcgct       480
     gcggcgatcg cgccggtgtt cctgaacgtc atcctgatcg gtgtgctggc ctatgcctgg       540
     tatagcggcc aggacccggt tgccgtcggc tatgggctct cctggggcgt catggccgcc       600
     ggcctcgtgc aactcgccat cgtctggatc gccgtccgca acgccgggat caagatcggt       660
     ttccgccgtc cgcggttgac cgccaatgtc cggcgcctgc tcgtcctggc gctgccggcg       720
     gcgatcaccg gcggcatcac ccagatcaac ctgctgatca acaccaacat cgcctcggcg       780
     caggaagggg cggtctcctc gctcgtctat gcggaccgta tctaccagct tcccctcggc       840
     gtcgtcggca tcgcggttgc gaccgtcctg ttgccggaat tgtcgcgcgc ccttcgggga       900
     ggcaatctca acgaggcggc gaacttgcag aaccgctccg tcgaattcac cctgttcctc       960
     accttgccgg ccgccgccgc gctgctcgtc atgtcggaac cgatcgtccg gctgcttttc      1020
     gagcgcggca agttctcgcc ggaagcgacc gtcgtcgtcg ggcatatcct ggcgatctac      1080
     ggcctcggcc tgccggcctt cgtgctgatc aaggccttca ttccgggctt tttcgcgcgc      1140
     gaggataccc gcacgccgat gatcttcgcg gcgatctccg tcgtggtgaa cgtgtcgctg      1200
     gcggtgacgc tgtttccgcc gctcggcgca agcggcatcg ccaccgccga gatcgttgcg      1260
     ggctgggtca atgcactgct cctcttcacg accctcctct ggcgcgggca ttggggccgc      1320
     gacatcccgc tgctgacgcg cgttccccgt ctcgtgatcg ccgctgcgat catggccgcg      1380
     gcgctccatt acgccatcga gtggttggct ttcccgcttt cctcggcggc gccgctcgcc      1440
     gtccgtgcgg caaccgtctg cggcctggtg gcggccgcca tggcgatcta tttcgcctcg      1500
     gccttcgggc tcggcggcgc cagcctggga atgatccggc gcagtttgaa acgcagggcc      1560
     gcgccggcgg ctgctccgac aacgggcgaa gggccggatt cgccgtga                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page