(data stored in ACNUC7421 zone)

EMBL: CP001389.PE101

CP001389.PE101       Location/Qualifiers
FT   CDS_pept        complement(110324..110887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01020"
FT                   /product="hypothetical protein contains Sel1-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23905"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF68"
FT                   /protein_id="ACP23905.1"
FT                   /translation="MDTRINPTIGRANALLLATAVLLSFAAVAAPSAHAADLTAAEQCD
FT                   REAGSELDLERNRAFPAVATQEIRIGVALSACREAYNQSGGARTQFQLARVLDRAGEKL
FT                   KSLQLLGEAAQNGHALAMAMYGIRLVERGEAEAAFDLYQRAAAAGNVVAARNLAVAYRD
FT                   GVGTRADGALAAQWFARAQTSKLQ"
     atggataccc ggatcaaccc gaccatcggc agggcaaatg cgcttctgct tgcaactgct        60
     gtgctgctgt cgttcgcggc ggtcgcggct ccttcggcgc atgcggccga tctcaccgcc       120
     gccgaacagt gcgaccggga agccggcagc gaactcgatc tcgagcgcaa ccgggccttt       180
     cccgccgtcg caacgcaaga aatccgcatc ggcgtcgcgc tatcggcctg tcgcgaggct       240
     tataaccaga gtggcggcgc tcgcacccag ttccagcttg cccgtgttct cgaccgggcc       300
     ggcgagaaac tgaaatcgct tcagctcctc ggcgaagcgg cgcaaaacgg ccacgctctg       360
     gcgatggcga tgtacggcat ccggctcgtg gaacgtggcg aggctgaagc ggccttcgac       420
     ctctaccaac gcgctgcggc cgccggcaat gtcgtcgcag cccgcaatct cgccgtcgcc       480
     tatcgggacg gtgtcggcac gcgggcagac ggcgcccttg cggcgcagtg gttcgcacgg       540
     gcgcagacga gcaagctcca gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page