(data stored in ACNUC7421 zone)

EMBL: CP001389.PE102

CP001389.PE102       Location/Qualifiers
FT   CDS_pept        111186..111806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23906"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF69"
FT                   /protein_id="ACP23906.1"
FT                   /translation="MPQLHINRRMVLGGLILAVVGCRTATAATGAVVGKAQKIRGNVRR
FT                   RQGDADERLAAGGAVLDRDYVTTSTNSFADLALSETRILLGPQTELLIDSFIAGEGGTL
FT                   ELGVGRMVFDRPQGLPKVDMAIRTAFGMIGVRGTKFFCGPSRAAAFAVFVEHGAVSVEG
FT                   GGIARRLTAGEGVDFDRPGGAPGEVTRWGQARIREAYASVGLR"
     atgccgcagc tgcatatcaa cagaaggatg gtgcttggcg gcctgatcct ggcggtggtc        60
     ggctgccgga cggcgacggc cgcgaccgga gcggtcgtcg gcaaggcgca aaagatccgc       120
     ggcaatgtcc gccgtcggca gggagacgcg gacgagcggc tcgccgcagg cggcgccgta       180
     ctcgaccggg actatgtcac gacgagcacc aacagttttg ccgatctcgc cctcagcgaa       240
     acacgcattc tgctcggacc gcagacggag ttgttgatcg acagcttcat cgccggcgag       300
     gggggcacgc tcgagctcgg cgtcgggcga atggtttttg accggccaca gggactgccg       360
     aaggtcgata tggcgatccg cacggccttc ggaatgatcg gcgttcgcgg cacgaagttt       420
     ttctgtggac ccagccgggc ggcagccttc gccgttttcg tcgagcacgg tgccgtcagc       480
     gtcgaaggcg ggggcatcgc gcggaggctg actgccggcg agggagtgga tttcgaccgg       540
     cccggcggag ctccaggtga agtgacgcga tgggggcagg cgcgcatccg cgaggcctat       600
     gcgagcgtcg gtctacgctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page