(data stored in ACNUC7421 zone)

EMBL: CP001389.PE106

CP001389.PE106       Location/Qualifiers
FT   CDS_pept        115492..115758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01070"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-12b"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23910"
FT                   /db_xref="GOA:C3MF73"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF73"
FT                   /protein_id="ACP23910.1"
FT                   /translation="MPDHVHMLISIPPKYSVSHIVGFLKGKTALYVANKYARKRRYKGY
FT                   HFWARGYFVSTAGYDEQVVRRYIRNQEKADKASDFADLFNRSY"
     atgcccgacc atgtgcatat gctgatctcg atcccgccga agtactcggt gtcgcacatt        60
     gtgggcttcc tgaagggcaa gacagccctt tacgtggcca acaaatatgc ccgcaagcgg       120
     cgctacaaag gctatcactt ttgggcgcgt gggtacttcg tctcaacggc tggctatgat       180
     gagcaggtcg tcagacgcta tatccgtaat caagaaaagg ccgacaaagc ttccgacttt       240
     gccgacctct ttaaccgtag ctactaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page