(data stored in ACNUC7421 zone)

EMBL: CP001389.PE107

CP001389.PE107       Location/Qualifiers
FT   CDS_pept        complement(115845..116273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01080"
FT                   /product="putative RbsD/FucU transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23911"
FT                   /db_xref="GOA:C3MF74"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF74"
FT                   /protein_id="ACP23911.1"
FT                   /translation="MLKGIDPILSPELLAALRAMGHGDEIALVDGNYPGQEHARRLVRL
FT                   DGHHLIPALDAILSVLPIDDFVPEAIFRATVKQDKDALDPVHRDIIACCRKHEPNQPVV
FT                   PLLGTEFYPRVRAAHTVVQTSEPRLYGNVILRKGVVYP"
     atgttaaagg gaatagaccc catcctgagc ccggaattgc ttgccgcgct cagggcaatg        60
     gggcatggcg acgagatcgc cctggtcgac gggaactatc cgggccagga acatgcccgc       120
     cggctggtgc ggctcgacgg ccatcatctg atccccgcgc tcgatgccat tctcagcgtg       180
     ctgccgatcg acgacttcgt gccggaggca atcttccgcg ccacggtcaa acaggacaag       240
     gacgcgcttg acccggtgca tcgggacatc atcgcatgct gccgcaagca cgagccgaac       300
     cagccggtcg ttccgcttct cggcacggaa ttctacccgc gcgtgagagc cgcccatacg       360
     gtggtgcaga ccagcgaacc gcgcctctac ggcaacgtca tcctgcgcaa gggggtggtc       420
     tacccctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page