(data stored in ACNUC7421 zone)

EMBL: CP001389.PE108

CP001389.PE108       Location/Qualifiers
FT   CDS_pept        complement(116274..117506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01090"
FT                   /product="putative ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23912"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF75"
FT                   /protein_id="ACP23912.1"
FT                   /translation="MSLTEDPHGGSAQPDVIDPSGGANQTRVRAYNERLVMSLVRRHGS
FT                   LSKAEIARRSGLSAQTVSVIMRALEADGMLIRGAPVRGRVGQPSIPMRLNPDAVYSFGV
FT                   KIGRRSADLVLMDFLGNIRLHLHQIHTYPLPGDLVTFIVKGIEKLEEKLGPEERKRIAG
FT                   VGIATPFELWNWAEEVGAPHEEMDKWHDFDLQAAVAARTRHPVFLQNDGTSACGAELAF
FT                   GVGASYPDFVYFYIGSFIGGGVVLNSALFSGRTGTAGAVGPLPVSGKDGKTTQLLKIAS
FT                   VFVLEKLLRERGMDPKPLWYSADDWIDFGEPLEVWIQDSAAALAQAVVSAVSIVDFSAA
FT                   VIDGGFPPWVRARLLTATRKALQTLDLQGVTLPDLVEGVVGSHARAIGGASLPLFSRYL
FT                   LDTNVLFKELT"
     atgtcactga cagaagatcc ccatggggga tcggcgcaac ccgacgtgat cgacccgagc        60
     ggcggggcga accagacgcg cgtgcgcgcc tataacgagc ggctggtcat gtcgctggtg       120
     cgtcgccacg gcagcctgtc caaggcggag atcgcgcgcc ggtccggact ttccgcccag       180
     acggtctcgg tcatcatgcg tgcgctcgag gcggacggga tgctcattcg tggcgcgcct       240
     gtgcgcggcc gggtcgggca gccgtccatc ccgatgcggc tcaatcccga tgccgtctat       300
     tccttcgggg tcaagatcgg ccgccgcagc gccgacctgg tgctgatgga tttcctcggc       360
     aacattcgcc tgcacctgca ccagatccac acctatcccc tgcccggcga cctcgtcacc       420
     ttcatcgtca aaggcataga gaagctcgag gagaaactcg gccccgagga acgcaagcgc       480
     atcgccggcg tcggcatcgc gacgcccttc gaattgtgga actgggcgga agaggtcggc       540
     gcgccgcacg aagaaatgga caagtggcac gatttcgacc tgcaggcggc ggtcgctgcg       600
     cggacgcgac atcccgtctt tctgcagaac gacggcacca gcgcctgcgg ggcggaactc       660
     gccttcggcg tcggcgccag ctatccggat ttcgtctatt tctatatcgg ctcgttcatc       720
     ggcggcggcg tcgtgctcaa ctccgcgctg ttctcgggcc gcaccggcac cgccggtgcc       780
     gtcggcccac tgccggtctc gggcaaagac ggcaagacaa cgcaactgct gaagatcgcc       840
     tcggtcttcg tcctcgagaa gctgttgcgc gaacgtggca tggatccgaa gccgctctgg       900
     tattcggccg acgactggat cgatttcggc gaaccgctcg aggtctggat ccaggattcg       960
     gcggcggcac tcgcccaggc ggtcgtctcg gccgtctcca tcgtcgattt ttccgccgcg      1020
     gtgatcgacg gcggcttccc gccctgggtg cgggcccgcc tgctgaccgc gacgcgcaag      1080
     gcgctgcaga cgctcgacct tcagggcgtc acgctgccgg accttgtcga aggcgtcgtc      1140
     ggcagccacg cccgggcgat cggcggagcg agcctgccgc tcttttcccg ctatctgctc      1200
     gataccaatg ttctcttcaa ggagcttacc tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page